| UniProt ID | RGS20_HUMAN | |
|---|---|---|
| UniProt AC | O76081 | |
| Protein Name | Regulator of G-protein signaling 20 | |
| Gene Name | RGS20 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 388 | |
| Subcellular Localization |
Membrane Lipid-anchor. Nucleus. Cytoplasm. Shuttles between the cytoplasm/cell membrane and the nucleus. Anchored to the membrane through palmitoylation.. |
|
| Protein Description | Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds selectively to G(z)-alpha and G(alpha)-i2 subunits, accelerates their GTPase activity and regulates their signaling activities. The G(z)-alpha activity is inhibited by the phosphorylation and palmitoylation of the G-protein. Negatively regulates mu-opioid receptor-mediated activation of the G-proteins (By similarity).. | |
| Protein Sequence | MPQLSQDNQECLQKHFSRPSIWTQFLPLFRAQRYNTDIHQITENEGDLRAVPDIKSFPPAQLPDSPAAPKLFGLLSSPLSSLARFFSHLLRRPPPEAPRRRLDFSPLLPALPAARLSRGHEELPGRLSLLLGAALALPGRPSGGRPLRPPHPVAKPREEDATAGQSSPMPQMGSERMEMRKRQMPAAQDTPGAAPGQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEDQRPTIASHELRADLPTWEESPAPTLEEVNAWAQSFDKLMVTPAGRNAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILSPKEVSLDSRVREVINRNMVEPSQHIFDDAQLQIYTLMHRDSYPRFMNSAVYKDLLQSLSEKSIEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 (in isoform 6) | Phosphorylation | - | 53.07 | 22199227 | |
| 13 (in isoform 6) | Phosphorylation | - | 49.16 | 21815630 | |
| 14 (in isoform 6) | Phosphorylation | - | 33.40 | 21815630 | |
| 77 | Phosphorylation | KLFGLLSSPLSSLAR HHHHHHCCHHHHHHH | 29.81 | - | |
| 162 | Phosphorylation | KPREEDATAGQSSPM CCCHHCCCCCCCCCC | 43.58 | - | |
| 166 | Phosphorylation | EDATAGQSSPMPQMG HCCCCCCCCCCCCCC | 35.18 | - | |
| 174 | Phosphorylation | SPMPQMGSERMEMRK CCCCCCCHHHHHHHH | 19.38 | - | |
| 190 | Phosphorylation | QMPAAQDTPGAAPGQ HCCCHHCCCCCCCCC | 16.13 | 28555341 | |
| 235 | Phosphorylation | DQRPTIASHELRADL CCCCCEECCHHHCCC | 17.40 | 24961811 | |
| 269 | Phosphorylation | SFDKLMVTPAGRNAF HHHHHEECHHHHHHH | 8.08 | 29523821 | |
| 315 | Phosphorylation | EEKARIIYEDYISIL HHHHHHHHHHHHHHH | 10.61 | 22817900 | |
| 318 | Phosphorylation | ARIIYEDYISILSPK HHHHHHHHHHHHCHH | 5.66 | 27642862 | |
| 323 | Phosphorylation | EDYISILSPKEVSLD HHHHHHHCHHHCCCC | 32.05 | 24719451 | |
| 328 | Phosphorylation | ILSPKEVSLDSRVRE HHCHHHCCCCHHHHH | 27.79 | 27470641 | |
| 358 | Phosphorylation | DAQLQIYTLMHRDSY HHHHHHHHHHHHCCC | 21.16 | - | |
| 384 | Ubiquitination | LLQSLSEKSIEA--- HHHHHHHHHHCC--- | 54.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RGS20_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RGS20_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RGS20_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
