BOLA1_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BOLA1_HUMAN
• UniProt AC: Q9Y3E2
• Protein Name: BolA-like protein 1 {ECO:0000305}
• Gene Name: BOLA1 {ECO:0000312|HGNC:HGNC:24263}
• Organism: Homo sapiens (Human).
• Sequence Length: 137
• Subcellular Localization: Mitochondrion .
• Protein Description: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5. [PubMed: 27532772 May protect cells against oxidative stress]
• Protein Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
39	Ubiquitination	VEAAIRTKLEEALSP HHHHHHHHHHHHHCH	44.01	29967540
45	Phosphorylation	TKLEEALSPEVLELR HHHHHHHCHHHHHHH	26.51	21815630
64	Phosphorylation	GHAVPPGSETHFRVA CCCCCCCCCCEEEEE	45.13	28555341
81	Phosphorylation	SSRFEGLSPLQRHRL CCCCCCCCHHHHHHH	34.13	19664994
118	Phosphorylation	PAQWRENSQLDTSPP HHHHHHCCCCCCCCC	27.63	21815630
122	Phosphorylation	RENSQLDTSPPCLGG HHCCCCCCCCCCCCC	52.29	25850435
123	Phosphorylation	ENSQLDTSPPCLGGN HCCCCCCCCCCCCCC	26.89	21712546
131	Acetylation	PPCLGGNKKTLGTP- CCCCCCCCCCCCCC-	50.87	26051181
133	Phosphorylation	CLGGNKKTLGTP--- CCCCCCCCCCCC---	31.84	26074081
136	Phosphorylation	GNKKTLGTP------ CCCCCCCCC------	29.01	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BOLA1_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BOLA1_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BOLA1_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A4_HUMAN	APP	physical	21832049
CA094_HUMAN	C1orf94	physical	25416956
PCBP1_HUMAN	PCBP1	physical	26344197
BOLA1_HUMAN	BOLA1	physical	27499296
EFGM_HUMAN	GFM1	physical	27499296
MPPB_HUMAN	PMPCB	physical	27499296
MPPA_HUMAN	PMPCA	physical	27499296
DHRS4_HUMAN	DHRS4	physical	27499296
GLRX5_HUMAN	GLRX5	physical	27499296
ODBA_HUMAN	BCKDHA	physical	27499296
S2551_HUMAN	SLC25A51	physical	27499296
ECH1_HUMAN	ECH1	physical	27499296
GLRX5_HUMAN	GLRX5	physical	27532773
PLS1_HUMAN	PLSCR1	physical	28514442
TINAG_HUMAN	TINAG	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"A probability-based approach for high-throughput proteinphosphorylation analysis and site localization.";
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.;
Nat. Biotechnol. 24:1285-1292(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-81, AND MASSSPECTROMETRY.
PubMed: 16964243