UniProt ID | BOLA1_HUMAN | |
---|---|---|
UniProt AC | Q9Y3E2 | |
Protein Name | BolA-like protein 1 {ECO:0000305} | |
Gene Name | BOLA1 {ECO:0000312|HGNC:HGNC:24263} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 137 | |
Subcellular Localization | Mitochondrion . | |
Protein Description | Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5. [PubMed: 27532772 May protect cells against oxidative stress] | |
Protein Sequence | MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
39 | Ubiquitination | VEAAIRTKLEEALSP HHHHHHHHHHHHHCH | 44.01 | 29967540 | |
45 | Phosphorylation | TKLEEALSPEVLELR HHHHHHHCHHHHHHH | 26.51 | 21815630 | |
64 | Phosphorylation | GHAVPPGSETHFRVA CCCCCCCCCCEEEEE | 45.13 | 28555341 | |
81 | Phosphorylation | SSRFEGLSPLQRHRL CCCCCCCCHHHHHHH | 34.13 | 19664994 | |
118 | Phosphorylation | PAQWRENSQLDTSPP HHHHHHCCCCCCCCC | 27.63 | 21815630 | |
122 | Phosphorylation | RENSQLDTSPPCLGG HHCCCCCCCCCCCCC | 52.29 | 25850435 | |
123 | Phosphorylation | ENSQLDTSPPCLGGN HCCCCCCCCCCCCCC | 26.89 | 21712546 | |
131 | Acetylation | PPCLGGNKKTLGTP- CCCCCCCCCCCCCC- | 50.87 | 26051181 | |
133 | Phosphorylation | CLGGNKKTLGTP--- CCCCCCCCCCCC--- | 31.84 | 26074081 | |
136 | Phosphorylation | GNKKTLGTP------ CCCCCCCCC------ | 29.01 | 26074081 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BOLA1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of BOLA1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BOLA1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
CA094_HUMAN | C1orf94 | physical | 25416956 | |
PCBP1_HUMAN | PCBP1 | physical | 26344197 | |
BOLA1_HUMAN | BOLA1 | physical | 27499296 | |
EFGM_HUMAN | GFM1 | physical | 27499296 | |
MPPB_HUMAN | PMPCB | physical | 27499296 | |
MPPA_HUMAN | PMPCA | physical | 27499296 | |
DHRS4_HUMAN | DHRS4 | physical | 27499296 | |
GLRX5_HUMAN | GLRX5 | physical | 27499296 | |
ODBA_HUMAN | BCKDHA | physical | 27499296 | |
S2551_HUMAN | SLC25A51 | physical | 27499296 | |
ECH1_HUMAN | ECH1 | physical | 27499296 | |
GLRX5_HUMAN | GLRX5 | physical | 27532773 | |
PLS1_HUMAN | PLSCR1 | physical | 28514442 | |
TINAG_HUMAN | TINAG | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A probability-based approach for high-throughput proteinphosphorylation analysis and site localization."; Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.; Nat. Biotechnol. 24:1285-1292(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-81, AND MASSSPECTROMETRY. |