| UniProt ID | S2551_HUMAN | |
|---|---|---|
| UniProt AC | Q9H1U9 | |
| Protein Name | Solute carrier family 25 member 51 | |
| Gene Name | SLC25A51 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 297 | |
| Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
| Protein Description | ||
| Protein Sequence | MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MMDSEAHEKRP ----CCCHHHHHHCC | 20.84 | 19664994 | |
| 65 | Phosphorylation | QQLYGIKTRDAILQL HHHHCCCCHHHHHHH | 31.68 | - | |
| 130 | Phosphorylation | VAAVLAGTTEAIFTP HHHHHCCCCHHCCCH | 18.82 | - | |
| 136 | Phosphorylation | GTTEAIFTPLERVQT CCCHHCCCHHHHHHH | 22.35 | - | |
| 143 | Phosphorylation | TPLERVQTLLQDHKH CHHHHHHHHHHHCCC | 26.95 | - | |
| 153 | Acetylation | QDHKHHDKFTNTYQA HHCCCHHHCCCHHHH | 50.13 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2551_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2551_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2551_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of S2551_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...