UniProt ID | S2551_HUMAN | |
---|---|---|
UniProt AC | Q9H1U9 | |
Protein Name | Solute carrier family 25 member 51 | |
Gene Name | SLC25A51 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 297 | |
Subcellular Localization |
Mitochondrion inner membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MMDSEAHEKRPPILTSSKQDISPHITNVGEMKHYLCGCCAAFNNVAITFPIQKVLFRQQLYGIKTRDAILQLRRDGFRNLYRGILPPLMQKTTTLALMFGLYEDLSCLLHKHVSAPEFATSGVAAVLAGTTEAIFTPLERVQTLLQDHKHHDKFTNTYQAFKALKCHGIGEYYRGLVPILFRNGLSNVLFFGLRGPIKEHLPTATTHSAHLVNDFICGGLLGAMLGFLFFPINVVKTRIQSQIGGEFQSFPKVFQKIWLERDRKLINLFRGAHLNYHRSLISWGIINATYEFLLKVI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MMDSEAHEKRP ----CCCHHHHHHCC | 20.84 | 19664994 | |
65 | Phosphorylation | QQLYGIKTRDAILQL HHHHCCCCHHHHHHH | 31.68 | - | |
130 | Phosphorylation | VAAVLAGTTEAIFTP HHHHHCCCCHHCCCH | 18.82 | - | |
136 | Phosphorylation | GTTEAIFTPLERVQT CCCHHCCCHHHHHHH | 22.35 | - | |
143 | Phosphorylation | TPLERVQTLLQDHKH CHHHHHHHHHHHCCC | 26.95 | - | |
153 | Acetylation | QDHKHHDKFTNTYQA HHCCCHHHCCCHHHH | 50.13 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S2551_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S2551_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S2551_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of S2551_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...