UniProt ID | GLRX5_HUMAN | |
---|---|---|
UniProt AC | Q86SX6 | |
Protein Name | Glutaredoxin-related protein 5, mitochondrial | |
Gene Name | GLRX5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 157 | |
Subcellular Localization | Mitochondrion matrix . | |
Protein Description | Monothiol glutaredoxin involved in the biogenesis of iron-sulfur clusters. [PubMed: 20364084 Involved in protein lipoylation, acting in the pathway that provides an iron-sulfur cluster to lipoate synthase] | |
Protein Sequence | MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | SGAGGGGSAEQLDAL CCCCCCCCHHHHHHH | 31.72 | - | |
53 | 2-Hydroxyisobutyrylation | DALVKKDKVVVFLKG HHHHCCCEEEEEECC | 45.89 | - | |
53 | Acetylation | DALVKKDKVVVFLKG HHHHCCCEEEEEECC | 45.89 | 25953088 | |
59 | Succinylation | DKVVVFLKGTPEQPQ CEEEEEECCCCCCCC | 49.64 | - | |
59 | Succinylation | DKVVVFLKGTPEQPQ CEEEEEECCCCCCCC | 49.64 | - | |
85 | Phosphorylation | RLHGVRDYAAYNVLD HHCCCCCCHHHHCCC | 5.20 | - | |
145 | Phosphorylation | LKKLGIHSALLDEKK HHHHCCCHHHHHHHC | 20.77 | 20068231 | |
151 | 2-Hydroxyisobutyrylation | HSALLDEKKDQDSK- CHHHHHHHCCCCCC- | 62.41 | - | |
156 | Phosphorylation | DEKKDQDSK------ HHHCCCCCC------ | 34.33 | 24719451 | |
157 | Acetylation | EKKDQDSK------- HHCCCCCC------- | 73.06 | 2380821 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GLRX5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GLRX5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GLRX5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
KEAP1_HUMAN | KEAP1 | physical | 21988832 | |
BOLA1_HUMAN | BOLA1 | physical | 26344197 | |
BOLA3_HUMAN | BOLA3 | physical | 26344197 | |
GLOD4_HUMAN | GLOD4 | physical | 26344197 | |
THIO_HUMAN | TXN | physical | 26344197 | |
BOLA1_HUMAN | BOLA1 | physical | 27532772 | |
BOLA3_HUMAN | BOLA3 | physical | 27532772 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
205950 | Anemia, sideroblastic, pyridoxine-refractory, autosomal recessive (PRARSA) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...