BOLA3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: BOLA3_HUMAN
• UniProt AC: Q53S33
• Protein Name: BolA-like protein 3 {ECO:0000305}
• Gene Name: BOLA3 {ECO:0000312|HGNC:HGNC:24415}
• Organism: Homo sapiens (Human).
• Sequence Length: 107
• Subcellular Localization: Mitochondrion .
• Protein Description: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with NFU1. [PubMed: 27532772]
• Protein Sequence: MAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
41	Malonylation	LRVTQILKEKFPRAT EEHHHHHHHHCCCCE	61.56	26320211
56	Phosphorylation	AIKVTDISGGCGAMY EEEEEECCCCCCEEE	31.76	22210691
62	Sulfoxidation	ISGGCGAMYEIKIES CCCCCCEEEEEEECC	1.55	21406390
102	Phosphorylation	MHGLRIFTSVPKR-- HHCCEEEEECCCC--	26.83	-
106	2-Hydroxyisobutyrylation	RIFTSVPKR------ EEEEECCCC------	69.46	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of BOLA3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of BOLA3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of BOLA3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
BOLA1_HUMAN	BOLA1	physical	26344197
BOLA3_HUMAN	BOLA3	physical	27499296
NDUS6_HUMAN	NDUFS6	physical	27499296
GLRX5_HUMAN	GLRX5	physical	27499296
PREP_HUMAN	PITRM1	physical	27499296
DDAH1_HUMAN	DDAH1	physical	27499296
ECH1_HUMAN	ECH1	physical	27499296
PPA6_HUMAN	ACP6	physical	27499296
C1QBP_HUMAN	C1QBP	physical	27499296
NRDC_HUMAN	NRD1	physical	27499296
GLRX5_HUMAN	GLRX5	physical	27532773

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.