UniProt ID | ALR_HUMAN | |
---|---|---|
UniProt AC | P55789 | |
Protein Name | FAD-linked sulfhydryl oxidase ALR | |
Gene Name | GFER | |
Organism | Homo sapiens (Human). | |
Sequence Length | 205 | |
Subcellular Localization |
Isoform 1: Mitochondrion intermembrane space. Mitochondrion . Isoform 2: Cytoplasm. Secreted. |
|
Protein Description | Isoform 1: FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen.; Isoform 2: May act as an autocrine hepatotrophic growth factor promoting liver regeneration.. | |
Protein Sequence | MAAPGERGRFHGGNLFFLPGGARSEMMDDLATDARGRGAGRRDAAASASTPAQAPTSDSPVAEDASRRRPCRACVDFKTWMRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 | Methylation | -MAAPGERGRFHGGN -CCCCCCCCCCCCCC | 47.72 | - | |
26 | Sulfoxidation | PGGARSEMMDDLATD CCCCCHHHHHHHHHH | 3.63 | 21406390 | |
50 | Phosphorylation | DAAASASTPAQAPTS HHHHCCCCCCCCCCC | 23.51 | 28555341 | |
56 | Phosphorylation | STPAQAPTSDSPVAE CCCCCCCCCCCCCHH | 48.45 | 18691976 | |
57 | Phosphorylation | TPAQAPTSDSPVAED CCCCCCCCCCCCHHH | 34.72 | 18669648 | |
59 | Phosphorylation | AQAPTSDSPVAEDAS CCCCCCCCCCHHHHH | 22.50 | 19409522 | |
66 | Phosphorylation | SPVAEDASRRRPCRA CCCHHHHHHCCCCCC | 38.35 | 29978859 | |
78 | Ubiquitination | CRACVDFKTWMRTQQ CCCHHCHHHHHHHHH | 36.49 | 22817900 | |
79 | Phosphorylation | RACVDFKTWMRTQQK CCHHCHHHHHHHHHH | 25.20 | - | |
83 | Phosphorylation | DFKTWMRTQQKRDTK CHHHHHHHHHHHCCC | 21.17 | - | |
137 | Phosphorylation | AQFIHLFSKFYPCEE HHHHHHHHHHCCHHH | 28.37 | 24719451 | |
183 | Ubiquitination | EVNRKLGKPDFDCSK HHHHHHCCCCCCCHH | 52.42 | 29967540 | |
190 | Ubiquitination | KPDFDCSKVDERWRD CCCCCCHHCCHHHHC | 61.10 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ALR_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ALR_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ALR_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ALR_HUMAN | GFER | physical | 11709497 | |
CSN5_HUMAN | COPS5 | physical | 11709497 | |
ALR_HUMAN | GFER | physical | 14500725 | |
CSN5_HUMAN | COPS5 | physical | 14500725 | |
CSN1_HUMAN | GPS1 | physical | 15304329 | |
CSN2_HUMAN | COPS2 | physical | 15304329 | |
CSN5_HUMAN | COPS5 | physical | 15304329 | |
CSN8_HUMAN | COPS8 | physical | 15304329 | |
SMAD2_HUMAN | SMAD2 | physical | 21988832 | |
PKHF2_HUMAN | PLEKHF2 | physical | 25416956 | |
GRHPR_HUMAN | GRHPR | physical | 26344197 | |
PCBP1_HUMAN | PCBP1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613076 | Myopathy, mitochondrial progressive, with congenital cataract, hearing loss and developmental delay (MPMCHD) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-59, AND MASSSPECTROMETRY. |