| UniProt ID | CSN2_HUMAN | |
|---|---|---|
| UniProt AC | P61201 | |
| Protein Name | COP9 signalosome complex subunit 2 | |
| Gene Name | COPS2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 443 | |
| Subcellular Localization | Cytoplasm . Nucleus . | |
| Protein Description | Essential component of the COP9 signalosome complex (CSN), a complex involved in various cellular and developmental processes. The CSN complex is an essential regulator of the ubiquitin (Ubl) conjugation pathway by mediating the deneddylation of the cullin subunits of SCF-type E3 ligase complexes, leading to decrease the Ubl ligase activity of SCF-type complexes such as SCF, CSA or DDB2. The complex is also involved in phosphorylation of p53/TP53, c-jun/JUN, IkappaBalpha/NFKBIA, ITPK1 and IRF8/ICSBP, possibly via its association with CK2 and PKD kinases. CSN-dependent phosphorylation of TP53 and JUN promotes and protects degradation by the Ubl system, respectively. Involved in early stage of neuronal differentiation via its interaction with NIF3L1.. | |
| Protein Sequence | MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAKPYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 48 | Ubiquitination | ALKEDDPKAALSSFQ HHCCCCHHHHHHHHH | 53.97 | - | |
| 56 | Ubiquitination | AALSSFQKVLELEGE HHHHHHHHHHHHCCC | 46.94 | - | |
| 64 | Ubiquitination | VLELEGEKGEWGFKA HHHHCCCCCCHHHHH | 73.34 | - | |
| 64 | Acetylation | VLELEGEKGEWGFKA HHHHCCCCCCHHHHH | 73.34 | 26051181 | |
| 83 | Phosphorylation | IKINFKLTNFPEMMN HHHHHHHCCHHHHHH | 35.09 | 20068231 | |
| 97 | Phosphorylation | NRYKQLLTYIRSAVT HHHHHHHHHHHHHHH | 26.04 | - | |
| 108 | Phosphorylation | SAVTRNYSEKSINSI HHHHCCCCHHHHHHH | 41.94 | 29759185 | |
| 111 | Phosphorylation | TRNYSEKSINSILDY HCCCCHHHHHHHHHH | 23.97 | 21406692 | |
| 114 | Phosphorylation | YSEKSINSILDYIST CCHHHHHHHHHHHHH | 23.90 | 21406692 | |
| 118 | Phosphorylation | SINSILDYISTSKQM HHHHHHHHHHHHHHH | 8.04 | 21406692 | |
| 120 | Phosphorylation | NSILDYISTSKQMDL HHHHHHHHHHHHHHH | 22.02 | 21406692 | |
| 121 | Phosphorylation | SILDYISTSKQMDLL HHHHHHHHHHHHHHH | 30.31 | 21406692 | |
| 122 | Phosphorylation | ILDYISTSKQMDLLQ HHHHHHHHHHHHHHH | 17.69 | 21406692 | |
| 150 | Acetylation | KNDRLWFKTNTKLGK CCCCEEEECCCCCCC | 29.32 | 25953088 | |
| 157 | Ubiquitination | KTNTKLGKLYLEREE ECCCCCCCHHHCHHH | 44.38 | - | |
| 157 | Acetylation | KTNTKLGKLYLEREE ECCCCCCCHHHCHHH | 44.38 | 25953088 | |
| 159 | Phosphorylation | NTKLGKLYLEREEYG CCCCCCHHHCHHHHH | 15.25 | 18083107 | |
| 165 | Phosphorylation | LYLEREEYGKLQKIL HHHCHHHHHHHHHHH | 18.14 | 18083107 | |
| 221 | Phosphorylation | LKALYEQSLHIKSAI HHHHHHHHHCHHHHC | 15.24 | 28857561 | |
| 225 | Ubiquitination | YEQSLHIKSAIPHPL HHHHHCHHHHCCCHH | 24.08 | - | |
| 232 (in isoform 2) | Ubiquitination | - | 3.71 | - | |
| 253 | Acetylation | LREGEFEKAHTDFFE ECCCCHHHHCHHHHH | 51.28 | 26822725 | |
| 253 | Ubiquitination | LREGEFEKAHTDFFE ECCCCHHHHCHHHHH | 51.28 | - | |
| 263 | Ubiquitination | TDFFEAFKNYDESGS HHHHHHHHCCCCCCC | 62.74 | - | |
| 268 | Phosphorylation | AFKNYDESGSPRRTT HHHCCCCCCCCCHHH | 41.49 | 28348404 | |
| 270 | Phosphorylation | KNYDESGSPRRTTCL HCCCCCCCCCHHHHH | 25.22 | 21815630 | |
| 279 | Phosphorylation | RRTTCLKYLVLANML CHHHHHHHHHHHHHH | 6.79 | 20068231 | |
| 300 | Ubiquitination | PFDSQEAKPYKNDPE CCCCCCCCCCCCCHH | 48.40 | - | |
| 302 | Phosphorylation | DSQEAKPYKNDPEIL CCCCCCCCCCCHHHH | 23.01 | - | |
| 331 | Ubiquitination | TEFEKILKTNHSNIM HHHHHHHHCCCCCCC | 51.24 | 21890473 | |
| 331 (in isoform 1) | Ubiquitination | - | 51.24 | 21890473 | |
| 331 | Acetylation | TEFEKILKTNHSNIM HHHHHHHHCCCCCCC | 51.24 | 26822725 | |
| 338 | Sulfoxidation | KTNHSNIMDDPFIRE HCCCCCCCCCHHHHH | 5.82 | 30846556 | |
| 338 (in isoform 2) | Ubiquitination | - | 5.82 | 21890473 | |
| 352 | Methylation | EHIEELLRNIRTQVL HHHHHHHHHHHHHHH | 49.51 | - | |
| 364 | Ubiquitination | QVLIKLIKPYTRIHI HHHHHHHHCCCEEEC | 42.27 | - | |
| 371 (in isoform 2) | Ubiquitination | - | 2.51 | - | |
| 415 | Ubiquitination | LLELDHQKRGGARYT HHHHHHHHCCCHHHH | 49.98 | 21890473 | |
| 415 | Acetylation | LLELDHQKRGGARYT HHHHHHHHCCCHHHH | 49.98 | 25953088 | |
| 415 (in isoform 1) | Ubiquitination | - | 49.98 | 21890473 | |
| 422 (in isoform 2) | Ubiquitination | - | 18.39 | 21890473 | |
| 426 | Acetylation | ARYTALDKWTNQLNS HHHHHHHHHHHHHHH | 57.69 | 26051181 | |
| 426 | Ubiquitination | ARYTALDKWTNQLNS HHHHHHHHHHHHHHH | 57.69 | 21890473 | |
| 426 (in isoform 1) | Ubiquitination | - | 57.69 | 21890473 | |
| 433 | Phosphorylation | KWTNQLNSLNQAVVS HHHHHHHHHHHHHHH | 36.97 | 28555341 | |
| 433 (in isoform 2) | Ubiquitination | - | 36.97 | 21890473 | |
| 441 | Ubiquitination | LNQAVVSKLA----- HHHHHHHHHC----- | 36.50 | - | |
| 441 (in isoform 1) | Ubiquitination | - | 36.50 | 21890473 | |
| 448 (in isoform 2) | Ubiquitination | - | 21890473 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CSN2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CSN2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CSN2_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
