| UniProt ID | SENP8_HUMAN | |
|---|---|---|
| UniProt AC | Q96LD8 | |
| Protein Name | Sentrin-specific protease 8 | |
| Gene Name | SENP8 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 212 | |
| Subcellular Localization | ||
| Protein Description | Protease that catalyzes two essential functions in the NEDD8 pathway: processing of full-length NEDD8 to its mature form and deconjugation of NEDD8 from targeted proteins such as cullins or p53.. | |
| Protein Sequence | MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLITTLAKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MDPVVLSY -------CCHHHHHH | 13.67 | 22223895 | |
| 7 | Phosphorylation | -MDPVVLSYMDSLLR -CCHHHHHHHHHHHH | 13.55 | 20068231 | |
| 8 | Phosphorylation | MDPVVLSYMDSLLRQ CCHHHHHHHHHHHHH | 10.77 | 20068231 | |
| 11 | Phosphorylation | VVLSYMDSLLRQSDV HHHHHHHHHHHHCCC | 16.87 | 20068231 | |
| 146 | Acetylation | FLGRKGDKLAFVEEK HHCCCCCEEEEEEEC | 50.84 | 19820343 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SENP8_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SENP8_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SENP8_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| AKIP1_HUMAN | AKIP1 | physical | 16998474 | |
| NEDD8_HUMAN | NEDD8 | physical | 12759363 | |
| NEDD8_HUMAN | NEDD8 | physical | 15775960 | |
| NEDD8_HUMAN | NEDD8 | physical | 19328766 | |
| NEDD8_HUMAN | NEDD8 | physical | 15567417 | |
| CUL1_HUMAN | CUL1 | physical | 20190741 | |
| CUL4A_HUMAN | CUL4A | physical | 20190741 | |
| RS14_HUMAN | RPS14 | physical | 23246961 | |
| CSN1_HUMAN | GPS1 | physical | 23408908 | |
| SMUF1_HUMAN | SMURF1 | physical | 24821572 | |
| CUL1_HUMAN | CUL1 | physical | 23408908 | |
| PA2GA_HUMAN | PLA2G2A | physical | 22118674 | |
| CUL2_HUMAN | CUL2 | physical | 12730221 | |
| TERF1_HUMAN | TERF1 | physical | 27214791 | |
| HDGR3_HUMAN | HDGFRP3 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
