UniProt ID | TR112_HUMAN | |
---|---|---|
UniProt AC | Q9UI30 | |
Protein Name | Multifunctional methyltransferase subunit TRM112-like protein | |
Gene Name | TRMT112 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Nucleus, nucleoplasm . Cytoplasm, perinuclear region . Localizes to a polarized perinuclear structure, overlapping partially with the Golgi and lysosomes (PubMed:25851604). | |
Protein Description | Acts as an activator of both rRNA/tRNA and protein methyltransferases. [PubMed: 25851604 Together with methyltransferase BUD23, methylates the N(7) position of a guanine in 18S rRNA] | |
Protein Sequence | MKLLTHNLLSSHVRGVGSRGFPLRLQATEVRICPVEFNPNFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Ubiquitination | ------MKLLTHNLL ------CCCHHHHHH | 52.80 | 21890473 | |
2 | Sumoylation | ------MKLLTHNLL ------CCCHHHHHH | 52.80 | - | |
2 | Sumoylation | ------MKLLTHNLL ------CCCHHHHHH | 52.80 | - | |
5 | Phosphorylation | ---MKLLTHNLLSSH ---CCCHHHHHHHHH | 21.10 | 26074081 | |
10 | Phosphorylation | LLTHNLLSSHVRGVG CHHHHHHHHHCCCCC | 22.89 | 26074081 | |
11 | Phosphorylation | LTHNLLSSHVRGVGS HHHHHHHHHCCCCCC | 26.43 | 26074081 | |
14 | Methylation | NLLSSHVRGVGSRGF HHHHHHCCCCCCCCC | 28.76 | 54556837 | |
24 | Methylation | GSRGFPLRLQATEVR CCCCCCCEEEECEEE | 25.62 | 115480001 | |
33 | S-nitrosylation | QATEVRICPVEFNPN EECEEEEECCCCCCC | 1.85 | 19483679 | |
33 | Glutathionylation | QATEVRICPVEFNPN EECEEEEECCCCCCC | 1.85 | 22555962 | |
33 | S-nitrosocysteine | QATEVRICPVEFNPN EECEEEEECCCCCCC | 1.85 | - | |
48 | Ubiquitination | FVARMIPKVEWSAFL HHHCCCCEECHHHHH | 41.69 | 21906983 | |
68 | Ubiquitination | LRLIQVPKGPVEGYE EEEEECCCCCCCCCH | 76.59 | 21906983 | |
74 | Phosphorylation | PKGPVEGYEENEEFL CCCCCCCCHHCHHHH | 13.43 | 22817900 | |
103 | Phosphorylation | GTLQCPESGRMFPIS EEEECCCCCCEEEEC | 19.49 | 26074081 | |
110 | Phosphorylation | SGRMFPISRGIPNML CCCEEEECCCCCCCC | 25.37 | 26074081 | |
119 | Phosphorylation | GIPNMLLSEEETES- CCCCCCCCHHHHCC- | 38.71 | 30266825 | |
123 | Phosphorylation | MLLSEEETES----- CCCCHHHHCC----- | 44.82 | 30266825 | |
125 | Phosphorylation | LSEEETES------- CCHHHHCC------- | 53.60 | 30266825 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of TR112_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of TR112_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of TR112_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CAND1_HUMAN | CAND1 | physical | 22863883 | |
IPO7_HUMAN | IPO7 | physical | 22863883 | |
SCOC_HUMAN | SCOC | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions."; Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.; Sci. Signal. 2:RA46-RA46(2009). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY. | |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-119, AND MASSSPECTROMETRY. |