UniProt ID | BEX1_HUMAN | |
---|---|---|
UniProt AC | Q9HBH7 | |
Protein Name | Protein BEX1 | |
Gene Name | BEX1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 125 | |
Subcellular Localization | Nucleus. Cytoplasm. Shuttles between the cytoplasm and the nucleus.. | |
Protein Description | Signaling adapter molecule involved in p75NTR/NGFR signaling. Plays a role in cell cycle progression and neuronal differentiation. Inhibits neuronal differentiation in response to nerve growth factor (NGF). May act as a link between the cell cycle and neurotrophic factor signaling, possibly by functioning as an upstream modulator of receptor signaling, coordinating biological responses to external signals with internal cellular states (By similarity).. | |
Protein Sequence | MESKEKRAVNSLSMENANQENEEKEQVANKGEPLALPLDAGEYCVPRGNRRRFRVRQPILQYRWDMMHRLGEPQARMREENMERIGEEVRQLMEKLREKQLSHSLRAVSTDPPHHDHHDEFCLMP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Phosphorylation | LPLDAGEYCVPRGNR EECCCCCCCCCCCCC | 9.60 | 27642862 | |
95 | Ubiquitination | EVRQLMEKLREKQLS HHHHHHHHHHHHHHH | 38.59 | 27667366 | |
99 | Ubiquitination | LMEKLREKQLSHSLR HHHHHHHHHHHHHHH | 50.54 | 27667366 | |
102 | Phosphorylation | KLREKQLSHSLRAVS HHHHHHHHHHHHHHC | 14.45 | - | |
104 | Phosphorylation | REKQLSHSLRAVSTD HHHHHHHHHHHHCCC | 19.04 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of BEX1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
102 | S | Phosphorylation |
| - |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of BEX1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TEX11_HUMAN | TEX11 | physical | 25416956 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...