dbPTM

MFSD3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	MFSD3_HUMAN
UniProt AC	Q96ES6
Protein Name	Major facilitator superfamily domain-containing protein 3
Gene Name	MFSD3
Organism	Homo sapiens (Human).
Sequence Length	412
Subcellular Localization	Membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MRGKLLPLAGLYLVQGLPYGLQSGLLPVLLRAGGLSLTRVGLAKVLYAPWLLKLAWAPLVDAQGSARAWVTRSTAGLGLVCGLLAGLPPPGAGQAGLPAAVAGLLLLLNLGAAMQDVALDALAVQLLEPAELGPGNTVQVVAYKLGAALAGGALLALLPTFSWPQLFLLLAATYWLAAALAWAAPALRRLPQQPPSEQRPHTAHLLRDVLAVPGTVWTAGFVLTYKLGEQGASSLFPLLLLDHGVSAPELGLWNGVGAVVCSIAGSSLGGTLLAKHWKLLPLLRSVLRFRLGGLACQTALVFHLDTLGASMDAGTILRGSALLSLCLQHFLGGLVTTVTFTGMMRCSQLAPRALQATHYSLLATLELLGKLLLGTLAGGLADGLGPHPCFLLLLILSAFPVLYLDLAPSTFL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	YLVQGLPYGLQSGLL HHHCCCCCCHHCCHH	35.20	22210691
23	Phosphorylation	GLPYGLQSGLLPVLL CCCCCHHCCHHHHHH	36.13	22210691
36	Phosphorylation	LLRAGGLSLTRVGLA HHHCCCCCCCHHHHH	30.85	24719451
38	Phosphorylation	RAGGLSLTRVGLAKV HCCCCCCCHHHHHHH	21.67	22210691
44	Ubiquitination	LTRVGLAKVLYAPWL CCHHHHHHHHHHHHH	37.50	33845483
65	Phosphorylation	PLVDAQGSARAWVTR HCCCCCCCHHHHHCH	11.51	26074081
71	Phosphorylation	GSARAWVTRSTAGLG CCHHHHHCHHHCHHH	14.27	26074081
73	Phosphorylation	ARAWVTRSTAGLGLV HHHHHCHHHCHHHHH	17.16	26074081
74	Phosphorylation	RAWVTRSTAGLGLVC HHHHCHHHCHHHHHH	22.81	26074081

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of MFSD3_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of MFSD3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of MFSD3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
PCDGK_HUMAN	PCDHGC3	physical	21988832

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of MFSD3_HUMAN

Related Literatures of Post-Translational Modification