| UniProt ID | NPDC1_HUMAN | |
|---|---|---|
| UniProt AC | Q9NQX5 | |
| Protein Name | Neural proliferation differentiation and control protein 1 | |
| Gene Name | NPDC1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 325 | |
| Subcellular Localization |
Membrane Single-pass membrane protein . |
|
| Protein Description | Suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. Might be involved in transcriptional regulation (By similarity).. | |
| Protein Sequence | MATPLPPPSPRHLRLLRLLLSGLVLGAALRGAAAGHPDVAACPGSLDCALKRRARCPPGAHACGPCLQPFQEDQQGLCVPRMRRPPGGGRPQPRLEDEIDFLAQELARKESGHSTPPLPKDRQRLPEPATLGFSARGQGLELGLPSTPGTPTPTPHTSLGSPVSSDPVHMSPLEPRGGQGDGLALVLILAFCVAGAAALSVASLCWCRLQREIRLTQKADYATAKAPGSPAAPRISPGDQRLAQSAEMYHYQHQRQQMLCLERHKEPPKELDTASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHAALSAPLPAPSSPPALP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MATPLPPPSP -----CCCCCCCCCH | 24.86 | 28111955 | |
| 9 | Phosphorylation | ATPLPPPSPRHLRLL CCCCCCCCHHHHHHH | 40.10 | 28111955 | |
| 114 | O-linked_Glycosylation | ARKESGHSTPPLPKD HHHHCCCCCCCCCCC | 46.24 | 55827631 | |
| 114 | Phosphorylation | ARKESGHSTPPLPKD HHHHCCCCCCCCCCC | 46.24 | - | |
| 115 | Phosphorylation | RKESGHSTPPLPKDR HHHCCCCCCCCCCCH | 24.21 | - | |
| 115 | O-linked_Glycosylation | RKESGHSTPPLPKDR HHHCCCCCCCCCCCH | 24.21 | 46511133 | |
| 130 | O-linked_Glycosylation | QRLPEPATLGFSARG HCCCCCCCCCCEECC | 37.82 | 55412979 | |
| 134 | O-linked_Glycosylation | EPATLGFSARGQGLE CCCCCCCEECCCCCC | 18.43 | 55830651 | |
| 161 | O-linked_Glycosylation | TPHTSLGSPVSSDPV CCCCCCCCCCCCCCC | 27.67 | OGP | |
| 164 | O-linked_Glycosylation | TSLGSPVSSDPVHMS CCCCCCCCCCCCCCC | 32.20 | OGP | |
| 216 | Phosphorylation | LQREIRLTQKADYAT HHHHHHHHHHCCHHC | 20.41 | 29978859 | |
| 218 | Ubiquitination | REIRLTQKADYATAK HHHHHHHHCCHHCCC | 37.68 | 21906983 | |
| 221 | Phosphorylation | RLTQKADYATAKAPG HHHHHCCHHCCCCCC | 15.65 | 28152594 | |
| 223 | Phosphorylation | TQKADYATAKAPGSP HHHCCHHCCCCCCCC | 23.59 | 29978859 | |
| 225 | Ubiquitination | KADYATAKAPGSPAA HCCHHCCCCCCCCCC | 51.24 | 32142685 | |
| 229 | Phosphorylation | ATAKAPGSPAAPRIS HCCCCCCCCCCCCCC | 15.42 | 23401153 | |
| 236 | Phosphorylation | SPAAPRISPGDQRLA CCCCCCCCHHCHHHH | 24.90 | 25159151 | |
| 245 | Phosphorylation | GDQRLAQSAEMYHYQ HCHHHHHHHHHHHHH | 22.16 | 26356563 | |
| 249 | Phosphorylation | LAQSAEMYHYQHQRQ HHHHHHHHHHHHHHH | 6.73 | 25884760 | |
| 251 | Phosphorylation | QSAEMYHYQHQRQQM HHHHHHHHHHHHHHH | 7.10 | 25884760 | |
| 275 | Phosphorylation | PKELDTASSDEENED CCCCCCCCCCCCCCC | 40.18 | 28348404 | |
| 276 | Phosphorylation | KELDTASSDEENEDG CCCCCCCCCCCCCCC | 46.72 | 28348404 | |
| 286 | Phosphorylation | ENEDGDFTVYECPGL CCCCCCCEEEECCCC | 27.24 | 28348404 | |
| 319 | Phosphorylation | SAPLPAPSSPPALP- CCCCCCCCCCCCCC- | 58.55 | 30278072 | |
| 320 | Phosphorylation | APLPAPSSPPALP-- CCCCCCCCCCCCC-- | 33.57 | 30278072 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NPDC1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NPDC1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NPDC1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...