UniProt ID | PRAF3_HUMAN | |
---|---|---|
UniProt AC | O75915 | |
Protein Name | PRA1 family protein 3 | |
Gene Name | ARL6IP5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . Cell membrane Multi-pass membrane protein . Cytoplasm . Cytoplasm, cytoskeleton . Also exists as a soluble form in the cytoplasm. Associated with microtubules. |
|
Protein Description | Regulates intracellular concentrations of taurine and glutamate. Negatively modulates SLC1A1/EAAC1 glutamate transport activity by decreasing its affinity for glutamate in a PKC activity-dependent manner. May be involved in membrane traffic.. | |
Protein Sequence | MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGFLSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVMVFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLTDYISKVKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MDVNIAPL -------CCCCCCCC | 13.49 | 22223895 | |
18 | Phosphorylation | WDDFFPGSDRFARPD CCCCCCCCCCCCCCC | 26.33 | 21712546 | |
31 | Ubiquitination | PDFRDISKWNNRVVS CCCCCHHHHCHHHHH | 55.03 | 21890473 | |
31 | Acetylation | PDFRDISKWNNRVVS CCCCCHHHHCHHHHH | 55.03 | 25953088 | |
31 | Malonylation | PDFRDISKWNNRVVS CCCCCHHHHCHHHHH | 55.03 | 26320211 | |
31 | Ubiquitination | PDFRDISKWNNRVVS CCCCCHHHHCHHHHH | 55.03 | 21890473 | |
151 | Acetylation | LKNKLENKMEGIGLK HHHHHHHHCCCCCCC | 29.02 | 27452117 | |
151 | Ubiquitination | LKNKLENKMEGIGLK HHHHHHHHCCCCCCC | 29.02 | 21890473 | |
152 | Sulfoxidation | KNKLENKMEGIGLKR HHHHHHHCCCCCCCC | 9.58 | 21406390 | |
158 | 2-Hydroxyisobutyrylation | KMEGIGLKRTPMGIV HCCCCCCCCCCCCHH | 49.35 | - | |
158 | Ubiquitination | KMEGIGLKRTPMGIV HCCCCCCCCCCCCHH | 49.35 | 21890473 | |
180 | Phosphorylation | EEGINRLTDYISKVK HHHHHHHHHHHHHHC | 24.42 | 26552605 | |
182 | Phosphorylation | GINRLTDYISKVKE- HHHHHHHHHHHHCC- | 11.23 | 29978859 | |
184 | Phosphorylation | NRLTDYISKVKE--- HHHHHHHHHHCC--- | 25.76 | 30108239 | |
185 | Ubiquitination | RLTDYISKVKE---- HHHHHHHHHCC---- | 48.01 | 21890473 | |
185 | Malonylation | RLTDYISKVKE---- HHHHHHHHHCC---- | 48.01 | 26320211 | |
185 | Ubiquitination | RLTDYISKVKE---- HHHHHHHHHCC---- | 48.01 | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRAF3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRAF3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRAF3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
XRCC1_HUMAN | XRCC1 | physical | 19208635 | |
RL5_HUMAN | RPL5 | physical | 22939629 | |
USP9X_HUMAN | USP9X | physical | 22939629 | |
RN185_HUMAN | RNF185 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides."; Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.; Nat. Biotechnol. 21:566-569(2003). Cited for: PROTEIN SEQUENCE OF 1-9, AND ACETYLATION AT MET-1. |