| UniProt ID | CCND2_HUMAN | |
|---|---|---|
| UniProt AC | P30279 | |
| Protein Name | G1/S-specific cyclin-D2 | |
| Gene Name | CCND2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 289 | |
| Subcellular Localization |
Nucleus . Cytoplasm . Membrane . Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members.. Isoform 2: Cytoplasm . |
|
| Protein Description | Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).. | |
| Protein Sequence | MELLCHEVDPVRRAVRDRNLLRDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKSHLQLLGAVCMFLASKLKETSPLTAEKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQREKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVSSLTCDALTELLAKITNTDVDCLKACQEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRDIDL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 45 | Ubiquitination | LPQCSYFKCVQKDIQ CCCCCHHHHHHHHCH | 25.84 | 23000965 | |
| 49 | Ubiquitination | SYFKCVQKDIQPYMR CHHHHHHHHCHHHHH | 36.08 | 23000965 | |
| 111 | Ubiquitination | VCMFLASKLKETSPL HHHHHHHHCCCCCCC | 58.95 | 22817900 | |
| 113 | Ubiquitination | MFLASKLKETSPLTA HHHHHHCCCCCCCCH | 63.78 | 22817900 | |
| 148 | Ubiquitination | LVVLGKLKWNLAAVT EHHHHHCCCCEEECC | 37.21 | - | |
| 173 | Ubiquitination | KLPQQREKLSLIRKH HCHHHHHHHHHHHHH | 45.63 | - | |
| 175 | Phosphorylation | PQQREKLSLIRKHAQ HHHHHHHHHHHHHHH | 32.58 | 24719451 | |
| 244 | Ubiquitination | NTDVDCLKACQEQIE CCCHHHHHHHHHHHH | 54.14 | 22817900 | |
| 269 | Phosphorylation | RQDQRDGSKSEDELD HHHCCCCCCCHHHHH | 36.98 | 30266825 | |
| 270 | Ubiquitination | QDQRDGSKSEDELDQ HHCCCCCCCHHHHHH | 64.49 | - | |
| 271 | Phosphorylation | DQRDGSKSEDELDQA HCCCCCCCHHHHHHC | 52.56 | 23401153 | |
| 279 | Phosphorylation | EDELDQASTPTDVRD HHHHHHCCCCCCHHH | 29.32 | 30108239 | |
| 280 | Phosphorylation | DELDQASTPTDVRDI HHHHHCCCCCCHHHC | 32.97 | 23927012 | |
| 282 | Phosphorylation | LDQASTPTDVRDIDL HHHCCCCCCHHHCCC | 47.41 | 30108239 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 280 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
| 280 | T | Phosphorylation | Kinase | MAPK14 | Q16539 | GPS |
| - | K | Ubiquitination | E3 ubiquitin ligase | FBXL2 | Q9UKC9 | PMID:22323446 |
| - | K | Ubiquitination | E3 ubiquitin ligase | FBXO31 | Q5XUX0 | PMID:21537837 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CCND2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CCND2_HUMAN !! | ||||||
loading...
