UniProt ID | CDN1C_HUMAN | |
---|---|---|
UniProt AC | P49918 | |
Protein Name | Cyclin-dependent kinase inhibitor 1C | |
Gene Name | CDKN1C | |
Organism | Homo sapiens (Human). | |
Sequence Length | 316 | |
Subcellular Localization | Nucleus. | |
Protein Description | Potent tight-binding inhibitor of several G1 cyclin/CDK complexes (cyclin E-CDK2, cyclin D2-CDK4, and cyclin A-CDK2) and, to lesser extent, of the mitotic cyclin B-CDC2. Negative regulator of cell proliferation. May play a role in maintenance of the non-proliferative state throughout life.. | |
Protein Sequence | MSDASLRSTSTMERLVARGTFPVLVRTSACRSLFGPVDHEELSRELQARLAELNAEDQNRWDYDFQQDMPLRGPGRLQWTEVDSDSVPAFYRETVQVGRCRLLLAPRPVAVAVAVSPPLEPAAESLDGLEEAPEQLPSVPVPAPASTPPPVPVLAPAPAPAPAPVAAPVAAPVAVAVLAPAPAPAPAPAPAPAPVAAPAPAPAPAPAPAPAPAPAPDAAPQESAEQGANQGQRGQEPLADQLHSGISGRPAAGTAAASANGAAIKKLSGPLISDFFAKRKRSAPEKSSGDVPAPCPSPSAAPGVGSVEQTPRKRLR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
27 | Phosphorylation | TFPVLVRTSACRSLF CCCEEEECHHHHHHH | 17.13 | 24719451 | |
43 | Phosphorylation | PVDHEELSRELQARL CCCHHHHHHHHHHHH | 27.30 | 24719451 | |
107 | Methylation | CRLLLAPRPVAVAVA EEEEECCCCEEEEEE | 32.49 | - | |
266 | Acetylation | ANGAAIKKLSGPLIS CCCHHHHHHHCCHHH | 41.60 | 30591107 | |
268 | Phosphorylation | GAAIKKLSGPLISDF CHHHHHHHCCHHHHH | 47.44 | 18669648 | |
275 | Ubiquitination | SGPLISDFFAKRKRS HCCHHHHHHHHCCCC | 5.25 | 21963094 | |
278 | Acetylation | LISDFFAKRKRSAPE HHHHHHHHCCCCCCC | 53.98 | 24468109 | |
282 | Phosphorylation | FFAKRKRSAPEKSSG HHHHCCCCCCCCCCC | 51.73 | - | |
286 | Ubiquitination | RKRSAPEKSSGDVPA CCCCCCCCCCCCCCC | 49.19 | 21963094 | |
286 | Phosphorylation | RKRSAPEKSSGDVPA CCCCCCCCCCCCCCC | 49.19 | 33259812 | |
287 | Phosphorylation | KRSAPEKSSGDVPAP CCCCCCCCCCCCCCC | 37.58 | 27251275 | |
288 | Phosphorylation | RSAPEKSSGDVPAPC CCCCCCCCCCCCCCC | 50.51 | 26552605 | |
297 | Phosphorylation | DVPAPCPSPSAAPGV CCCCCCCCCCCCCCC | 37.90 | 25159151 | |
299 | Phosphorylation | PAPCPSPSAAPGVGS CCCCCCCCCCCCCCC | 41.21 | 27050516 | |
306 | Phosphorylation | SAAPGVGSVEQTPRK CCCCCCCCCCCCCCH | 21.78 | 26552605 | |
310 | Phosphorylation | GVGSVEQTPRKRLR- CCCCCCCCCCHHCC- | 16.14 | 12925736 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
282 | S | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
310 | T | Phosphorylation | Kinase | AKT1 | P31749 | PSP |
- | K | Ubiquitination | E3 ubiquitin ligase | SKP2 | Q13309 | PMID:12925736 |
- | K | Ubiquitination | E3 ubiquitin ligase | FBXL12 | Q9NXK8 | PMID:22199232 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CDN1C_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDN1C_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
LIMK1_HUMAN | LIMK1 | physical | 14530263 | |
SKP2_HUMAN | SKP2 | physical | 12925736 | |
PCNA_HUMAN | PCNA | physical | 9465025 | |
MYOD1_HUMAN | MYOD1 | physical | 10764802 | |
CCND1_HUMAN | CCND1 | physical | 10764802 | |
CCNE2_HUMAN | CCNE2 | physical | 9840943 | |
AKT1_HUMAN | AKT1 | physical | 23421998 | |
CSN5_HUMAN | COPS5 | physical | 26606000 | |
CCND1_HUMAN | CCND1 | physical | 10713702 | |
CDN1C_HUMAN | CDKN1C | physical | 10713702 | |
CDK4_HUMAN | CDK4 | physical | 10713702 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
130650 | Beckwith-Wiedemann syndrome (BWS) | |||||
614732 | Intrauterine growth retardation, metaphyseal dysplasia, adrenal hypoplasia congenita, and genital anomalies (IMAGE) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-268, AND MASSSPECTROMETRY. |