| UniProt ID | DYLT1_HUMAN | |
|---|---|---|
| UniProt AC | P63172 | |
| Protein Name | Dynein light chain Tctex-type 1 | |
| Gene Name | DYNLT1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 113 | |
| Subcellular Localization | Golgi apparatus. Cytoplasm. Cytoplasm, cytoskeleton, spindle. Localizes to mitotic spindles.. | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Binds to transport cargos and is involved in apical cargo transport such as rhodopsin-bearing vesicles in polarized epithelia. May also be a accessory component of axonemal dynein.; Plays a role in neuronal morphogenesis; the function is independent of cytoplasmic dynein and seems to be coupled to regulation of the actin cytoskeleton by enhancing Rac1 activity. The function in neurogenesis may be regulated by association with a G-protein beta-gamma dimer. May function as a receptor-independent activator of heterotrimeric G-protein signaling; the activation appears to be independent of a nucleotide exchange. Plays a role in regulating neurogenesis; inhibits the genesis of neurons from precursor cells during cortical development presumably by antagonizing ARHGEF2. Involved in the regulation of mitotic spindle orientation (By similarity). Unrelated to the role in retrograde microtubule-associated movement may play a role in the dimerization of cytoplasmic proteins/domains such as for ACVR2B. Binds to the cytoplasmic domain of ACVR2B and, in vitro, inhibits ACVR2B signaling. [PubMed: 27502274; (Microbial infection) Is involved in intracellular targeting of D-type retrovirus gag polyproteins to the cytoplasmic assembly site.] | |
| Protein Sequence | MEDYQAAEETAFVVDEVSNIVKEAIESAIGGNAYQHSKVNQWTTNVVEQTLSQLTKLGKPFKYIVTCVIMQKNGAGLHTASSCFWDSSTDGSCTVRWENKTMYCIVSAFGLSI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEDYQAAE -------CCCHHHHH | 8.80 | 22223895 | |
| 4 | Phosphorylation | ----MEDYQAAEETA ----CCCHHHHHHHC | 6.17 | 25106551 | |
| 10 | Phosphorylation | DYQAAEETAFVVDEV CHHHHHHHCEEHHHH | 19.53 | 25106551 | |
| 18 | Phosphorylation | AFVVDEVSNIVKEAI CEEHHHHHHHHHHHH | 20.84 | 25867546 | |
| 24 | Ubiquitination | VSNIVKEAIESAIGG HHHHHHHHHHHHHCC | 12.72 | 22817900 | |
| 38 | Ubiquitination | GNAYQHSKVNQWTTN CCCCCCHHHCHHHHH | 42.98 | 21963094 | |
| 42 | Ubiquitination | QHSKVNQWTTNVVEQ CCHHHCHHHHHHHHH | 10.45 | 23000965 | |
| 45 | Ubiquitination | KVNQWTTNVVEQTLS HHCHHHHHHHHHHHH | 28.58 | 23000965 | |
| 48 | Ubiquitination | QWTTNVVEQTLSQLT HHHHHHHHHHHHHHH | 33.30 | 23000965 | |
| 56 | Ubiquitination | QTLSQLTKLGKPFKY HHHHHHHHCCCCCEE | 64.93 | 21890473 | |
| 56 | Ubiquitination | QTLSQLTKLGKPFKY HHHHHHHHCCCCCEE | 64.93 | 23000965 | |
| 59 | Ubiquitination | SQLTKLGKPFKYIVT HHHHHCCCCCEEEEE | 58.69 | 23000965 | |
| 62 | Ubiquitination | TKLGKPFKYIVTCVI HHCCCCCEEEEEEEE | 42.46 | 23000965 | |
| 79 | Phosphorylation | KNGAGLHTASSCFWD CCCCCEEEEEECEEC | 33.02 | - | |
| 81 | Phosphorylation | GAGLHTASSCFWDSS CCCEEEEEECEECCC | 28.88 | - | |
| 82 | Phosphorylation | AGLHTASSCFWDSST CCEEEEEECEECCCC | 15.74 | 22817900 | |
| 94 | Phosphorylation | SSTDGSCTVRWENKT CCCCCCEEEEECCCC | 18.14 | 21394082 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYLT1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYLT1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYLT1_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Acetylation | |
| Reference | PubMed |
| "Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, AND MASS SPECTROMETRY. | |
