TC1D2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TC1D2_HUMAN
• UniProt AC: Q8WW35
• Protein Name: Tctex1 domain-containing protein 2
• Gene Name: TCTEX1D2
• Organism: Homo sapiens (Human).
• Sequence Length: 142
• Protein Description: Required for proper retrograde ciliary transport..
• Protein Sequence: MATSIGVSFSVGDGVPEAEKNAGEPENTYILRPVFQQRFRPSVVKDCIHAVLKEELANAEYSPEEMPQLTKHLSENIKDKLKEMGFDRYKMVVQVVIGEQRGEGVFMASRCFWDADTDNYTHDVFMNDSLFCVVAAFGCFYY

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Acetylation	DCIHAVLKEELANAE HHHHHHHHHHHHCCC	42.41	25038526

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TC1D2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TC1D2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TC1D2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
WDR60_HUMAN	WDR60	physical	28514442
WDR34_HUMAN	WDR34	physical	28514442
AB17B_HUMAN	ABHD17B	physical	28514442
CLMN_HUMAN	CLMN	physical	28514442
ABTB2_HUMAN	ABTB2	physical	28514442
SNX6_HUMAN	SNX6	physical	28514442
SNX2_HUMAN	SNX2	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.