| UniProt ID | WDR34_HUMAN | |
|---|---|---|
| UniProt AC | Q96EX3 | |
| Protein Name | WD repeat-containing protein 34 | |
| Gene Name | WDR34 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 536 | |
| Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton, cilium basal body . Cytoplasm, cytoskeleton, cilium axoneme . Concentrates around the centrioles and basal bodies also showing axonemal staining.. | |
| Protein Description | Critical for ciliary functions, essential to normal development and survival, most probably as a previously unrecognized component of the mammalian dynein-motor-based intraflagellar transport (IFT) machinery. Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Inhibits the MAP3K7-induced NF-kappa-B activation pathway. Inhibits MAP3K7 phosphorylation at 'Thr-184' and 'Thr-187' upon Il-1 beta stimulation.. | |
| Protein Sequence | MATRAQPGPLSQAGSAGVAALATVGVASGPGPGRPGPLQDETLGVASVPSQWRAVQGIRWETKSCQTASIATASASAQARNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGHSHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of WDR34_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR34_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR34_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR34_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| TRAF6_HUMAN | TRAF6 | physical | 19521662 | |
| TAB3_HUMAN | TAB3 | physical | 19521662 | |
| TAB2_HUMAN | TAB2 | physical | 19521662 | |
| M3K7_HUMAN | MAP3K7 | physical | 19521662 | |
| TCPW_HUMAN | CCT6B | physical | 28514442 | |
| TCPB_HUMAN | CCT2 | physical | 28514442 | |
| TCPG_HUMAN | CCT3 | physical | 28514442 | |
| UBR4_HUMAN | UBR4 | physical | 28514442 | |
| TBC31_HUMAN | TBC1D31 | physical | 28514442 | |
| TCPZ_HUMAN | CCT6A | physical | 28514442 | |
| TCPD_HUMAN | CCT4 | physical | 28514442 | |
| TCPA_HUMAN | TCP1 | physical | 28514442 | |
| TC1D2_HUMAN | TCTEX1D2 | physical | 27173435 | |
| DLRB1_HUMAN | DYNLRB1 | physical | 27173435 | |
| H33_HUMAN | H3F3A | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 615633 | Short-rib thoracic dysplasia 11 with or without polydactyly (SRTD11) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
