UniProt ID | WDR34_HUMAN | |
---|---|---|
UniProt AC | Q96EX3 | |
Protein Name | WD repeat-containing protein 34 | |
Gene Name | WDR34 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 536 | |
Subcellular Localization | Cytoplasm . Cytoplasm, cytoskeleton, cilium basal body . Cytoplasm, cytoskeleton, cilium axoneme . Concentrates around the centrioles and basal bodies also showing axonemal staining.. | |
Protein Description | Critical for ciliary functions, essential to normal development and survival, most probably as a previously unrecognized component of the mammalian dynein-motor-based intraflagellar transport (IFT) machinery. Acts as a negative regulator of the Toll-like and IL-1R receptor signaling pathways. Inhibits the MAP3K7-induced NF-kappa-B activation pathway. Inhibits MAP3K7 phosphorylation at 'Thr-184' and 'Thr-187' upon Il-1 beta stimulation.. | |
Protein Sequence | MATRAQPGPLSQAGSAGVAALATVGVASGPGPGRPGPLQDETLGVASVPSQWRAVQGIRWETKSCQTASIATASASAQARNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFEVNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWSTLKSFVCAWNLDRRDLRPQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGHSHRFQVLSVATDGKVLLWQGIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAVAFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPREAEDLDCLAAEVAA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of WDR34_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of WDR34_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of WDR34_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of WDR34_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRAF6_HUMAN | TRAF6 | physical | 19521662 | |
TAB3_HUMAN | TAB3 | physical | 19521662 | |
TAB2_HUMAN | TAB2 | physical | 19521662 | |
M3K7_HUMAN | MAP3K7 | physical | 19521662 | |
TCPW_HUMAN | CCT6B | physical | 28514442 | |
TCPB_HUMAN | CCT2 | physical | 28514442 | |
TCPG_HUMAN | CCT3 | physical | 28514442 | |
UBR4_HUMAN | UBR4 | physical | 28514442 | |
TBC31_HUMAN | TBC1D31 | physical | 28514442 | |
TCPZ_HUMAN | CCT6A | physical | 28514442 | |
TCPD_HUMAN | CCT4 | physical | 28514442 | |
TCPA_HUMAN | TCP1 | physical | 28514442 | |
TC1D2_HUMAN | TCTEX1D2 | physical | 27173435 | |
DLRB1_HUMAN | DYNLRB1 | physical | 27173435 | |
H33_HUMAN | H3F3A | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
615633 | Short-rib thoracic dysplasia 11 with or without polydactyly (SRTD11) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...