UniProt ID | DLRB1_HUMAN | |
---|---|---|
UniProt AC | Q9NP97 | |
Protein Name | Dynein light chain roadblock-type 1 | |
Gene Name | DYNLRB1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 96 | |
Subcellular Localization | Cytoplasm, cytoskeleton. | |
Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.. | |
Protein Sequence | MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAEVEETLK ------CHHHHHHHH | 29.55 | - | |
9 | Ubiquitination | AEVEETLKRLQSQKG HHHHHHHHHHHHCCC | 59.49 | - | |
15 | Ubiquitination | LKRLQSQKGVQGIIV HHHHHHCCCCCEEEE | 67.31 | 20972266 | |
15 (in isoform 1) | Ubiquitination | - | 67.31 | 21890473 | |
40 | Phosphorylation | TMDNPTTTQYASLMH CCCCCCHHHHHHHHH | 23.28 | 28348404 | |
44 | Phosphorylation | PTTTQYASLMHSFIL CCHHHHHHHHHHHHH | 22.69 | 28348404 | |
48 | Phosphorylation | QYASLMHSFILKARS HHHHHHHHHHHHHHH | 10.46 | 28348404 | |
52 | Ubiquitination | LMHSFILKARSTVRD HHHHHHHHHHHCCCC | 36.62 | 21890473 | |
52 (in isoform 1) | Ubiquitination | - | 36.62 | 21890473 | |
67 | Phosphorylation | IDPQNDLTFLRIRSK CCCCCCEEEEEEEEC | 24.40 | 21712546 | |
73 | Phosphorylation | LTFLRIRSKKNEIMV EEEEEEEECCCEEEE | 45.68 | - | |
75 | Ubiquitination | FLRIRSKKNEIMVAP EEEEEECCCEEEECC | 62.14 | 21906983 | |
75 (in isoform 1) | Ubiquitination | - | 62.14 | 21890473 | |
84 | Ubiquitination | EIMVAPDKDYFLIVI EEEECCCCCEEEEEE | 53.95 | 2190698 | |
84 (in isoform 1) | Ubiquitination | - | 53.95 | 21890473 | |
86 | Phosphorylation | MVAPDKDYFLIVIQN EECCCCCEEEEEEEC | 13.16 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
73 | S | Phosphorylation | Kinase | PRKACA | P17612 | GPS |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLRB1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLRB1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DYHC1_HUMAN | DYNC1H1 | physical | 22939629 | |
DYL1_HUMAN | DYNLL1 | physical | 22939629 | |
FLNC_HUMAN | FLNC | physical | 22939629 | |
DYLT1_HUMAN | DYNLT1 | physical | 22939629 | |
PLOD3_HUMAN | PLOD3 | physical | 22939629 | |
SEPT2_HUMAN | SEPT2 | physical | 22939629 | |
LTOR2_HUMAN | LAMTOR2 | physical | 22939629 | |
SAFB1_HUMAN | SAFB | physical | 22939629 | |
RT26_HUMAN | MRPS26 | physical | 22939629 | |
DC1I2_HUMAN | DYNC1I2 | physical | 22863883 | |
DC1L1_HUMAN | DYNC1LI1 | physical | 22863883 | |
DC1L2_HUMAN | DYNC1LI2 | physical | 22863883 | |
TC1D2_HUMAN | TCTEX1D2 | physical | 27173435 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |