LTOR2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: LTOR2_HUMAN
• UniProt AC: Q9Y2Q5
• Protein Name: Ragulator complex protein LAMTOR2
• Gene Name: LAMTOR2
• Organism: Homo sapiens (Human).
• Sequence Length: 125
• Subcellular Localization: Late endosome membrane; Peripheral membrane protein; Cytoplasmic side. Lysosome membrane; Peripheral membrane protein; Cytoplasmic side.
• Protein Description: As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2..
• Protein Sequence: MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVTAAIASNIWAAYDRNGNQAFNEDNLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGMLKAKAQALVQYLEEPLTQVAAS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70	Ubiquitination	AFNEDNLKFILMDCM CCCCHHHHEEHHHHH	36.29	-
98	Phosphorylation	LCMYAKETVGFGMLK HHHHHHCCCCCCHHH	25.81	20068231
107	Ubiquitination	GFGMLKAKAQALVQY CCCHHHHHHHHHHHH	39.17	-
120	Phosphorylation	QYLEEPLTQVAAS-- HHHHCHHHHHHCC--	31.54	28102081
125	Phosphorylation	PLTQVAAS------- HHHHHHCC-------	30.89	27251275
125	Phosphorylation	PLTQVAAS------- HHHHHHCC-------	30.89	28348404

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of LTOR2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of LTOR2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of LTOR2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
LTOR3_HUMAN	LAMTOR3	physical	11266467
LTOR3_HUMAN	LAMTOR3	physical	22939629
RT21_HUMAN	MRPS21	physical	22939629
LTOR5_HUMAN	LAMTOR5	physical	22980980
LTOR4_HUMAN	LAMTOR4	physical	22980980
LTOR3_HUMAN	LAMTOR3	physical	20381137
LTOR1_HUMAN	LAMTOR1	physical	20381137
RRAGB_HUMAN	RRAGB	physical	20381137
RRAGD_HUMAN	RRAGD	physical	20381137
MTOR_HUMAN	MTOR	physical	20381137
RPTOR_HUMAN	RPTOR	physical	20381137
RRAGA_HUMAN	RRAGA	physical	20381137
RRAGC_HUMAN	RRAGC	physical	20381137
LTOR3_HUMAN	LAMTOR3	physical	21516116
S38A9_HUMAN	SLC38A9	physical	25567906
VA0D1_HUMAN	ATP6V0D1	physical	25567906
VATB2_HUMAN	ATP6V1B2	physical	25567906
RRAGC_HUMAN	RRAGC	physical	25567906
RRAGA_HUMAN	RRAGA	physical	25567906
LTOR1_HUMAN	LAMTOR1	physical	25567906

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.