| UniProt ID | LTOR5_HUMAN | |
|---|---|---|
| UniProt AC | O43504 | |
| Protein Name | Ragulator complex protein LAMTOR5 | |
| Gene Name | LAMTOR5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 91 | |
| Subcellular Localization | Cytoplasm. Lysosome. | |
| Protein Description | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.. | |
| Protein Sequence | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEATLEQH -------CCCHHHHH | 25944712 | ||
| 17 | Phosphorylation | EDTMKNPSIVGVLCT HHHHCCCCEEEEEEE | 27080861 | ||
| 24 | Phosphorylation | SIVGVLCTDSQGLNL CEEEEEEECCCCCCC | 25850435 | ||
| 26 | Phosphorylation | VGVLCTDSQGLNLGC EEEEEECCCCCCCCC | 17525332 | ||
| 36 | Phosphorylation | LNLGCRGTLSDEHAG CCCCCCCCCCHHHHH | 21712546 | ||
| 38 | Phosphorylation | LGCRGTLSDEHAGVI CCCCCCCCHHHHHHH | 21712546 | ||
| 83 | Phosphorylation | IQKHDGITVAVHKMA EEEECCEEEEEEECC | 20068231 | ||
| 91 | Phosphorylation | VAVHKMAS------- EEEEECCC------- | 20068231 | ||
| 108 | Phosphorylation | ------------------------ ------------------------ | 17525332 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 26 | S | Phosphorylation | Kinase | ATM | Q13315 | PSP |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LTOR5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LTOR5_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...