UniProt ID | LTOR5_HUMAN | |
---|---|---|
UniProt AC | O43504 | |
Protein Name | Ragulator complex protein LAMTOR5 | |
Gene Name | LAMTOR5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 91 | |
Subcellular Localization | Cytoplasm. Lysosome. | |
Protein Description | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. When complexed to BIRC5, interferes with apoptosome assembly, preventing recruitment of pro-caspase-9 to oligomerized APAF1, thereby selectively suppressing apoptosis initiated via the mitochondrial/cytochrome c pathway. Down-regulates hepatitis B virus (HBV) replication.. | |
Protein Sequence | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAVHKMAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEATLEQH -------CCCHHHHH | 25944712 | ||
17 | Phosphorylation | EDTMKNPSIVGVLCT HHHHCCCCEEEEEEE | 27080861 | ||
24 | Phosphorylation | SIVGVLCTDSQGLNL CEEEEEEECCCCCCC | 25850435 | ||
26 | Phosphorylation | VGVLCTDSQGLNLGC EEEEEECCCCCCCCC | 17525332 | ||
36 | Phosphorylation | LNLGCRGTLSDEHAG CCCCCCCCCCHHHHH | 21712546 | ||
38 | Phosphorylation | LGCRGTLSDEHAGVI CCCCCCCCHHHHHHH | 21712546 | ||
83 | Phosphorylation | IQKHDGITVAVHKMA EEEECCEEEEEEECC | 20068231 | ||
91 | Phosphorylation | VAVHKMAS------- EEEEECCC------- | 20068231 | ||
108 | Phosphorylation | ------------------------ ------------------------ | 17525332 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
26 | S | Phosphorylation | Kinase | ATM | Q13315 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LTOR5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LTOR5_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...