UniProt ID | LTOR4_HUMAN | |
---|---|---|
UniProt AC | Q0VGL1 | |
Protein Name | Ragulator complex protein LAMTOR4 | |
Gene Name | LAMTOR4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 99 | |
Subcellular Localization | Lysosome . | |
Protein Description | As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated.. | |
Protein Sequence | MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTACGFRLHRGMNVPFKRLSVVFGEHTLLVTVSGQRVFVVKRQNRGREPIDV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MTSALTQG -------CCCHHHHH | 22814378 | ||
2 | Acetylation | ------MTSALTQGL ------CCCHHHHHH | 20068231 | ||
2 | Phosphorylation | ------MTSALTQGL ------CCCHHHHHH | 20068231 | ||
3 | Phosphorylation | -----MTSALTQGLE -----CCCHHHHHHH | 23186163 | ||
6 | Phosphorylation | --MTSALTQGLERIP --CCCHHHHHHHHCH | 20068231 | ||
64 | Ubiquitination | RGMNVPFKRLSVVFG CCCCCCCCEEEEEEC | - | ||
64 | 2-Hydroxyisobutyrylation | RGMNVPFKRLSVVFG CCCCCCCCEEEEEEC | - | ||
64 | Malonylation | RGMNVPFKRLSVVFG CCCCCCCCEEEEEEC | 26320211 | ||
64 | Acetylation | RGMNVPFKRLSVVFG CCCCCCCCEEEEEEC | 25953088 | ||
67 | Phosphorylation | NVPFKRLSVVFGEHT CCCCCEEEEEECCCE | - | ||
88 | Ubiquitination | GQRVFVVKRQNRGRE CEEEEEEEECCCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LTOR4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LTOR4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LTOR4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S38A9_HUMAN | SLC38A9 | physical | 25567906 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...