| UniProt ID | MOC2A_HUMAN | |
|---|---|---|
| UniProt AC | O96033 | |
| Protein Name | Molybdopterin synthase sulfur carrier subunit {ECO:0000255|HAMAP-Rule:MF_03051} | |
| Gene Name | MOCS2 {ECO:0000255|HAMAP-Rule:MF_03051} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 88 | |
| Subcellular Localization | Cytoplasm, cytosol . | |
| Protein Description | Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin.. | |
| Protein Sequence | MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 15 | Phosphorylation | EVLYFAKSAEITGVR EEEEEEEECEECCCE | 27.92 | - | |
| 25 | Phosphorylation | ITGVRSETISVPQEI ECCCEECCCCCCHHH | 21.57 | - | |
| 33 | Ubiquitination | ISVPQEIKALQLWKE CCCCHHHHHHHHHHH | 42.14 | 21890473 | |
| 39 | Ubiquitination | IKALQLWKEIETRHP HHHHHHHHHHHHCCC | 58.36 | - | |
| 88 | 1-thioglycine | VIPPISGG------- EECCCCCC------- | 27.80 | - | |
| 88 | Other | VIPPISGG------- EECCCCCC------- | 27.80 | 15073332 | |
| 88 | Thiocarboxylation | VIPPISGG------- EECCCCCC------- | 27.80 | 12732628 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MOC2A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MOC2A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MOC2A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of MOC2A_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| OMIM Disease | ||||||
| 252160 | Molybdenum cofactor deficiency, complementation group B (MOCODB) | |||||
| Kegg Drug | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
