| UniProt ID | DYLT3_HUMAN | |
|---|---|---|
| UniProt AC | P51808 | |
| Protein Name | Dynein light chain Tctex-type 3 | |
| Gene Name | DYNLT3 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 116 | |
| Subcellular Localization | Nucleus. Cytoplasm, cytoskeleton. Chromosome, centromere, kinetochore. Colocalizes with BUB3 at kinetochores specifically during prometaphase. | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Probably binds BUB3 as part of transport cargo. Required for the efficient progression through mitosis (By similarity).. | |
| Protein Sequence | MEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Nitrated tyrosine | ----MEEYHRHCDEV ----CHHHHHCHHCC | 7.28 | - | |
| 4 | Nitration | ----MEEYHRHCDEV ----CHHHHHCHHCC | 7.28 | - | |
| 57 | Ubiquitination | QSLTHLVKLGKAYKY HHHHHHHHHHHHHHH | 58.86 | 29967540 | |
| 93 | Phosphorylation | WDTTSDGTCTVRWEN EEECCCCEEEEEECC | 15.25 | - | |
| 95 | Phosphorylation | TTSDGTCTVRWENRT ECCCCEEEEEECCCC | 16.97 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYLT3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYLT3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYLT3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CHP3_HUMAN | TESC | physical | 16189514 | |
| DYLT3_HUMAN | DYNLT3 | physical | 16189514 | |
| DC1L2_HUMAN | DYNC1LI2 | physical | 22863883 | |
| RS16_HUMAN | RPS16 | physical | 22863883 | |
| RS29_HUMAN | RPS29 | physical | 22863883 | |
| RS3_HUMAN | RPS3 | physical | 22863883 | |
| PAIRB_HUMAN | SERBP1 | physical | 22863883 | |
| DYLT3_HUMAN | DYNLT3 | physical | 25416956 | |
| NIF3L_HUMAN | NIF3L1 | physical | 25416956 | |
| LIS1_HUMAN | PAFAH1B1 | physical | 27173435 | |
| TC1D2_HUMAN | TCTEX1D2 | physical | 27173435 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
