| UniProt ID | CHP3_HUMAN | |
|---|---|---|
| UniProt AC | Q96BS2 | |
| Protein Name | Calcineurin B homologous protein 3 | |
| Gene Name | TESC | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 214 | |
| Subcellular Localization |
Nucleus . Cytoplasm . Membrane Lipid-anchor . Cell membrane . Cell projection, lamellipodium . Cell projection, ruffle membrane . Colocalizes with SLC9A1 at the plasma membrane. |
|
| Protein Description | Functions as an integral cofactor in cell pH regulation by controlling plasma membrane-type Na(+)/H(+) exchange activity. Promotes the maturation, transport, cell surface stability and exchange activity of SLC9A1/NHE1 at the plasma membrane. Promotes the induction of hematopoietic stem cell differentiation toward megakaryocytic lineage. Essential for the coupling of ERK cascade activation with the expression of ETS family genes in megakaryocytic differentiation. Also involved in granulocytic differentiation in a ERK-dependent manner. Inhibits the phosphatase activity of calcineurin.. | |
| Protein Sequence | MGAAHSASEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGPSGLADEINFEDFLTIMSYFRPIDTTMDEEQVELSRKEKLRFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASVCMGQMEPDQVYEGITFEDFLKIWQGIDIETKMHVRFLNMETMALCH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Myristoylation | ------MGAAHSASE ------CCCCCCCHH | 14661968 | ||
| 8 | Phosphorylation | MGAAHSASEEVRELE CCCCCCCHHHHHHHC | 24275569 | ||
| 17 | Ubiquitination | EVRELEGKTGFSSDQ HHHHHCCCCCCCHHH | 33845483 | ||
| 21 | Ubiquitination | LEGKTGFSSDQIEQL HCCCCCCCHHHHHHH | 21890473 | ||
| 33 | Ubiquitination | EQLHRRFKQLSGDQP HHHHHHHHHHHCCCC | 21906983 | ||
| 36 | Phosphorylation | HRRFKQLSGDQPTIR HHHHHHHHCCCCCCC | 23312004 | ||
| 44 | Ubiquitination | GDQPTIRKENFNNVP CCCCCCCCHHCCCCC | 33845483 | ||
| 86 | Ubiquitination | LADEINFEDFLTIMS CCCCCCHHHHHHHHH | 21890473 | ||
| 86 (in isoform 1) | Ubiquitination | - | 21890473 | ||
| 86 (in isoform 2) | Ubiquitination | - | 21890473 | ||
| 151 | Ubiquitination | SGNPHIEKESARSIA CCCCCCCHHHHHHHH | - | ||
| 156 | Phosphorylation | IEKESARSIADGAMM CCHHHHHHHHHHHHH | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CHP3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CHP3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CHP3_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CCD91_HUMAN | CCDC91 | physical | 16189514 | |
| SL9A1_HUMAN | SLC9A1 | physical | 11696366 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
