| UniProt ID | DLRB2_HUMAN | |
|---|---|---|
| UniProt AC | Q8TF09 | |
| Protein Name | Dynein light chain roadblock-type 2 | |
| Gene Name | DYNLRB2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 96 | |
| Subcellular Localization | Cytoplasm, cytoskeleton. | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.. | |
| Protein Sequence | MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQNPCE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAEVEETLK ------CHHHHHHHH | 29.55 | - | |
| 9 | Ubiquitination | AEVEETLKRIQSHKG HHHHHHHHHHHHCCC | 55.67 | - | |
| 13 | Phosphorylation | ETLKRIQSHKGVIGT HHHHHHHHCCCCCEE | 25.46 | - | |
| 52 | Acetylation | LLHHLTMKAKSTVRD HHHHHHHHCCCCCCC | 47.64 | 25038526 | |
| 67 | Phosphorylation | IDPQNDLTFLRIRSK CCCCCCEEEEEEECC | 24.40 | 21712546 | |
| 73 | Phosphorylation | LTFLRIRSKKHEIMV EEEEEEECCCCEEEE | 43.62 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLRB2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLRB2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLRB2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| T2H2L_HUMAN | GTF2H2C | physical | 27173435 | |
| WDR34_HUMAN | WDR34 | physical | 27173435 | |
| TC1D2_HUMAN | TCTEX1D2 | physical | 27173435 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
