UniProt ID | LSM5_HUMAN | |
---|---|---|
UniProt AC | Q9Y4Y9 | |
Protein Name | U6 snRNA-associated Sm-like protein LSm5 | |
Gene Name | LSM5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 91 | |
Subcellular Localization | Nucleus. | |
Protein Description | Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating formation of the spliceosomal U4/U6 duplex formation in vitro.. | |
Protein Sequence | MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNITMLVPGGEGPEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAANATTNP ------CCCCCCCCH | 14.93 | 22223895 | |
6 | Phosphorylation | --MAANATTNPSQLL --CCCCCCCCHHHCC | 27.24 | 19664995 | |
20 | Ubiquitination | LPLELVDKCIGSRIH CCHHHHHHHHCCCEE | 21.92 | 21890473 | |
67 | Phosphorylation | TPEGRRITKLDQILL CCCCCCCCCHHEEEE | 24.60 | 27461979 | |
68 | Acetylation | PEGRRITKLDQILLN CCCCCCCCHHEEEEC | 47.93 | 23236377 | |
68 | Ubiquitination | PEGRRITKLDQILLN CCCCCCCCHHEEEEC | 47.93 | - | |
80 | Phosphorylation | LLNGNNITMLVPGGE EECCCCEEEEEECCC | 13.43 | 27461979 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSM5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSM5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSM5_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |