UniProt ID | AKA7A_HUMAN | |
---|---|---|
UniProt AC | O43687 | |
Protein Name | A-kinase anchor protein 7 isoforms alpha and beta | |
Gene Name | AKAP7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 104 | |
Subcellular Localization |
Isoform Alpha: Lateral cell membrane Lipid-anchor. Targeted predominantly to the lateral membrane. Isoform Beta: Apical cell membrane Lipid-anchor. Targeted predominantly to the apical membrane. |
|
Protein Description | Targets the cAMP-dependent protein kinase (PKA) to the plasma membrane, and permits functional coupling to the L-type calcium channel. The membrane-associated form reduces epithelial sodium channel (ENaC) activity, whereas the free cytoplasmic form may negatively regulate ENaC channel feedback inhibition by intracellular sodium.. | |
Protein Sequence | MGQLCCFPFSRDEGKISELESSSSAVLQRYSKDIPSWSSGEKNGGEPDDAELVRLSKRLVENAVLKAVQQYLEETQNKNKPGEGSSVKTEAADQNGNDNENNRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | N-myristoyl glycine | ------MGQLCCFPF ------CCCCCCEEC | 29.21 | - | |
2 | Myristoylation | ------MGQLCCFPF ------CCCCCCEEC | 29.21 | 9545239 | |
5 | S-palmitoylation | ---MGQLCCFPFSRD ---CCCCCCEECCCC | 1.40 | 9545239 | |
6 | S-palmitoylation | --MGQLCCFPFSRDE --CCCCCCEECCCCC | 7.07 | 9545239 | |
17 | Phosphorylation | SRDEGKISELESSSS CCCCCCHHHCHHCCH | 39.35 | 23312004 | |
21 | Phosphorylation | GKISELESSSSAVLQ CCHHHCHHCCHHHHH | 48.41 | 26657352 | |
22 | Phosphorylation | KISELESSSSAVLQR CHHHCHHCCHHHHHH | 20.95 | 46161483 | |
23 | Phosphorylation | ISELESSSSAVLQRY HHHCHHCCHHHHHHH | 31.43 | 23312004 | |
24 | Phosphorylation | SELESSSSAVLQRYS HHCHHCCHHHHHHHC | 25.09 | 23532336 | |
31 | Phosphorylation | SAVLQRYSKDIPSWS HHHHHHHCCCCCCCC | 26.49 | 23532336 | |
36 | Phosphorylation | RYSKDIPSWSSGEKN HHCCCCCCCCCCCCC | 39.67 | 26657352 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AKA7A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AKA7A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AKA7A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SP17_HUMAN | SPA17 | physical | 25416956 | |
ROP1A_HUMAN | ROPN1 | physical | 25416956 | |
CEP76_HUMAN | CEP76 | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Myristoylation | |
Reference | PubMed |
"A novel lipid-anchored A-kinase anchoring protein facilitates cAMP-responsive membrane events."; Fraser I.D.C., Tavalin S.J., Lester L.B., Langeberg L.K.,Westphal A.M., Dean R.A., Marrion N.V., Scott J.D.; EMBO J. 17:2261-2272(1998). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), FUNCTION, SUBCELLULARLOCATION, TISSUE SPECIFICITY, MYRISTOYLATION AT GLY-2, ANDPALMITOYLATION AT CYS-5 AND CYS-6. | |
Palmitoylation | |
Reference | PubMed |
"A novel lipid-anchored A-kinase anchoring protein facilitates cAMP-responsive membrane events."; Fraser I.D.C., Tavalin S.J., Lester L.B., Langeberg L.K.,Westphal A.M., Dean R.A., Marrion N.V., Scott J.D.; EMBO J. 17:2261-2272(1998). Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM ALPHA), FUNCTION, SUBCELLULARLOCATION, TISSUE SPECIFICITY, MYRISTOYLATION AT GLY-2, ANDPALMITOYLATION AT CYS-5 AND CYS-6. |