UniProt ID | ROP1A_HUMAN | |
---|---|---|
UniProt AC | Q9HAT0 | |
Protein Name | Ropporin-1A | |
Gene Name | ROPN1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 212 | |
Subcellular Localization | Cell projection, cilium, flagellum . In the sperm tail, found in the principal piece and in the cytoplasmic droplet located at the distal end of the midpiece. Inner surface of the fibrous sheath. | |
Protein Description | Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation.. | |
Protein Sequence | MAQTDKPTCIPPELPKMLKEFAKAAIRVQPQDLIQWAADYFEALSRGETPPVRERSERVALCNRAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGSPRIPFSTFQFLYTYIAKVDGEISASHVSRMLNYMEQEVIGPDGIITVNDFTQNPRVQLE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Phosphorylation | ADYFEALSRGETPPV HHHHHHHHCCCCCCC | 45.33 | 30622161 | |
49 | Phosphorylation | EALSRGETPPVRERS HHHHCCCCCCCCCHH | 35.40 | 30622161 | |
56 | Phosphorylation | TPPVRERSERVALCN CCCCCCHHHHHHHCC | 25.63 | 30622161 | |
77 | Phosphorylation | ELLKILHSQVAGRLI HHHHHHHHHHCHHHE | 23.93 | 30622161 | |
101 | Phosphorylation | WKVVNLPTDLFNSVM HHHCCCCHHHHHHHH | 48.80 | 25693802 | |
106 | Phosphorylation | LPTDLFNSVMNVGRF CCHHHHHHHHCCCCH | 18.53 | 30622161 | |
146 | Phosphorylation | KIVCEVLSCDHNGGS HHHHHHHCCCCCCCC | 23.75 | - | |
153 | Phosphorylation | SCDHNGGSPRIPFST CCCCCCCCCCCCHHH | 16.65 | - | |
159 | Phosphorylation | GSPRIPFSTFQFLYT CCCCCCHHHHHHHHH | 23.98 | 23898821 | |
178 | Phosphorylation | VDGEISASHVSRMLN CCCEEEHHHHHHHHH | 20.03 | 30622161 | |
181 | Phosphorylation | EISASHVSRMLNYME EEEHHHHHHHHHHHH | 13.42 | 30622161 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ROP1A_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ROP1A_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ROP1A_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ROP1A_HUMAN | ROPN1 | physical | 25416956 | |
UBE2W_HUMAN | UBE2W | physical | 25416956 | |
KIF9_HUMAN | KIF9 | physical | 25416956 | |
LENG1_HUMAN | LENG1 | physical | 25416956 | |
LNX1_HUMAN | LNX1 | physical | 25416956 | |
XKR3_HUMAN | XKR3 | physical | 25416956 | |
CNST_HUMAN | CNST | physical | 25416956 | |
RTP5_HUMAN | RTP5 | physical | 25416956 | |
CE57L_HUMAN | CEP57L1 | physical | 25416956 | |
ROP1B_HUMAN | ROPN1B | physical | 28514442 | |
MBNL1_HUMAN | MBNL1 | physical | 28514442 | |
KAP3_HUMAN | PRKAR2B | physical | 28514442 | |
S27A2_HUMAN | SLC27A2 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...