ROP1B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ROP1B_HUMAN
• UniProt AC: Q9BZX4
• Protein Name: Ropporin-1B
• Gene Name: ROPN1B
• Organism: Homo sapiens (Human).
• Sequence Length: 212
• Subcellular Localization: Cell projection, cilium, flagellum . In the sperm tail, found in the principal piece and in the cytoplasmic droplet located at the distal end of the midpiece. Inner surface of the fibrous sheath.
• Protein Description: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA-dependent signaling processes required for spermatozoa capacitation..
• Protein Sequence: MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
45	Phosphorylation	ADYFEALSRGETPPV HHHHHHHHCCCCCCC	45.33	30622161
49	Phosphorylation	EALSRGETPPVRERS HHHHCCCCCCCCCHH	35.40	30622161
56	Phosphorylation	TPPVRERSERVALCN CCCCCCHHHHHHHCC	25.63	30622161
73	Acetylation	ELTPELLKILHSQVA HHCHHHHHHHHHHHC	56.71	25038526
77	Phosphorylation	ELLKILHSQVAGRLI HHHHHHHHHHCHHHE	23.93	30622161
101	Phosphorylation	WKVVNLPTDLFNSVM HHHCCCCHHHHHHHH	48.80	25693802
106	Phosphorylation	LPTDLFNSVMNVGRF CCHHHHHHHHCCCCH	18.53	30622161

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ROP1B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ROP1B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ROP1B_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of ROP1B_HUMAN !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.