UniProt ID | UBE2W_HUMAN | |
---|---|---|
UniProt AC | Q96B02 | |
Protein Name | Ubiquitin-conjugating enzyme E2 W | |
Gene Name | UBE2W | |
Organism | Homo sapiens (Human). | |
Sequence Length | 151 | |
Subcellular Localization | Nucleus . In the nucleus, colocalizes with FANCL. | |
Protein Description | Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. [PubMed: 20061386 Specifically monoubiquitinates the N-terminus of various substrates, including ATXN3, MAPT/TAU, POLR2H/RPB8 and STUB1/CHIP, by recognizing backbone atoms of disordered N-termini] | |
Protein Sequence | MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCKEKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
7 (in isoform 2) | Phosphorylation | - | 26.01 | - | |
29 | Phosphorylation | GMTLNEKSVQNSITQ CCCCCHHHHHHHHHH | 23.82 | - | |
33 | Phosphorylation | NEKSVQNSITQWIVD CHHHHHHHHHHHHHC | 15.21 | - | |
39 | Ubiquitination | NSITQWIVDMEGAPG HHHHHHHHCCCCCCC | 5.37 | - | |
129 | Phosphorylation | KRRPPDNSFYVRTCN HCCCCCCCEEEEECC | 25.90 | 28555341 | |
175 (in isoform 3) | Phosphorylation | - | 27642862 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of UBE2W_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference |
---|---|---|---|---|
1 | M | ubiquitylation |
| 23560854 |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of UBE2W_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...