UniProt ID | FANCL_HUMAN | |
---|---|---|
UniProt AC | Q9NW38 | |
Protein Name | E3 ubiquitin-protein ligase FANCL | |
Gene Name | FANCL | |
Organism | Homo sapiens (Human). | |
Sequence Length | 375 | |
Subcellular Localization | Cytoplasm. Nucleus. | |
Protein Description | Ubiquitin ligase protein that mediates monoubiquitination of FANCD2 in the presence of UBE2T, a key step in the DNA damage pathway. [PubMed: 12973351] | |
Protein Sequence | MAVTEASLLRQCPLLLPQNRSKTVYEGFISAQGRDFHLRIVLPEDLQLKNARLLCSWQLRTILSGYHRIVQQRMQHSPDLMSFMMELKMLLEVALKNRQELYALPPPPQFYSSLIEEIGTLGWDKLVYADTCFSTIKLKAEDASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQSSLISIYSQFLAAIESLKAFWDVMDEIDEKTWVLEPEKPPRSATARRIALGNNVSINIEVDPRHPTMLPECFFLGADHVVKPLGIKLSRNIHLWDPENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTIPDQVCDNSQCGQPFHQICLYEWLRGLLTSRQSFNIIFGECPYCSKPITLKMSGRKH | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAVTEASLL ------CCCCHHHHH | 19.55 | 22814378 | |
4 | Phosphorylation | ----MAVTEASLLRQ ----CCCCHHHHHHH | 19.12 | 24719451 | |
7 | Phosphorylation | -MAVTEASLLRQCPL -CCCCHHHHHHHCCC | 23.00 | 24719451 | |
22 (in isoform 2) | Ubiquitination | - | 38.48 | - | |
22 | Ubiquitination | LLPQNRSKTVYEGFI CCCCCCCCCEEEEEE | 38.48 | 21906983 | |
49 (in isoform 2) | Ubiquitination | - | 35.28 | - | |
49 | Ubiquitination | LPEDLQLKNARLLCS CCHHHHCCCHHHHHH | 35.28 | 33845483 | |
77 | Phosphorylation | VQQRMQHSPDLMSFM HHHHHHCCCCHHHHH | 11.83 | 29038488 | |
82 | Phosphorylation | QHSPDLMSFMMELKM HCCCCHHHHHHHHHH | 19.79 | 29038488 | |
128 | Phosphorylation | LGWDKLVYADTCFST CCCCCEEEECCCEEE | 14.81 | 29496907 | |
139 | Sumoylation | CFSTIKLKAEDASGR CEEEEEEEEECCCCC | 44.73 | - | |
139 | Ubiquitination | CFSTIKLKAEDASGR CEEEEEEEEECCCCC | 44.73 | - | |
139 | Sumoylation | CFSTIKLKAEDASGR CEEEEEEEEECCCCC | 44.73 | - | |
144 | Ubiquitination | KLKAEDASGREHLIT EEEEECCCCCEEEEE | 51.18 | 21963094 | |
149 | Ubiquitination | DASGREHLITLKLKA CCCCCEEEEEEEEEE | 2.47 | 21963094 | |
153 | Ubiquitination | REHLITLKLKAKYPA CEEEEEEEEEECCCC | 39.01 | 29967540 | |
154 | Ubiquitination | EHLITLKLKAKYPAE EEEEEEEEEECCCCC | 7.99 | 21963094 | |
164 | Ubiquitination | KYPAESPDYFVDFPV CCCCCCCCEEECCCC | 59.80 | 21963094 | |
169 | Ubiquitination | SPDYFVDFPVPFCAS CCCEEECCCCCCCCC | 5.74 | 21963094 | |
178 | Phosphorylation | VPFCASWTPQSSLIS CCCCCCCCCHHHHHH | 14.68 | - | |
218 | Ubiquitination | TWVLEPEKPPRSATA EEEECCCCCCCCCCC | 71.66 | 29967540 | |
223 | Ubiquitination | PEKPPRSATARRIAL CCCCCCCCCCCEEEC | 13.42 | 29967540 | |
261 | Ubiquitination | LGADHVVKPLGIKLS CCCCEECCCCCCEEE | 33.17 | 21963094 | |
266 | Ubiquitination | VVKPLGIKLSRNIHL ECCCCCCEEECCEEE | 38.31 | 21963094 | |
266 (in isoform 2) | Ubiquitination | - | 38.31 | - | |
271 | Ubiquitination | GIKLSRNIHLWDPEN CCEEECCEEEECCCC | 2.47 | 21963094 | |
271 (in isoform 2) | Ubiquitination | - | 2.47 | - | |
276 | Ubiquitination | RNIHLWDPENSVLQN CCEEEECCCCCHHHH | 30.96 | 21963094 | |
281 | Ubiquitination | WDPENSVLQNLKDVL ECCCCCHHHHHHHHH | 2.54 | 21963094 | |
286 | Ubiquitination | SVLQNLKDVLEIDFP CHHHHHHHHHCCCCC | 54.09 | 21963094 | |
347 | Phosphorylation | EWLRGLLTSRQSFNI HHHHHHHHCCCCEEE | 27.23 | 24719451 | |
351 | Phosphorylation | GLLTSRQSFNIIFGE HHHHCCCCEEEEEEE | 21.10 | - | |
364 | Ubiquitination | GECPYCSKPITLKMS EECCCCCCCEEEEEC | 36.56 | - | |
369 (in isoform 2) | Ubiquitination | - | 23.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
178 | T | Phosphorylation | Kinase | GSK3B | P49841 | PSP |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FANCL_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FANCL_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614083 | Fanconi anemia complementation group L (FANCL) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...