UniProt ID | FANCF_HUMAN | |
---|---|---|
UniProt AC | Q9NPI8 | |
Protein Name | Fanconi anemia group F protein | |
Gene Name | FANCF | |
Organism | Homo sapiens (Human). | |
Sequence Length | 374 | |
Subcellular Localization | Nucleus . | |
Protein Description | DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability (By similarity).. | |
Protein Sequence | MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
164 | Ubiquitination | LQEDSLMKTQAELLL CCCCHHHHHHHHHHH | 42.66 | 21906983 | |
179 | Ubiquitination | ERLQEVGKAEAERPA HHHHHHCHHHHHHHH | 48.51 | - | |
190 | Phosphorylation | ERPARFLSSLWERLP HHHHHHHHHHHHHCC | 22.22 | 22817900 | |
191 | Phosphorylation | RPARFLSSLWERLPQ HHHHHHHHHHHHCCC | 39.38 | 24260401 | |
322 | Ubiquitination | CQAPPPLKDKVLTAL HCCCCCCCHHHHHHH | 62.37 | - | |
324 | Ubiquitination | APPPLKDKVLTALET CCCCCCHHHHHHHHH | 37.24 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FANCF_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FANCF_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FANCF_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
603467 | Fanconi anemia complementation group F (FANCF) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...