| UniProt ID | FANCF_HUMAN | |
|---|---|---|
| UniProt AC | Q9NPI8 | |
| Protein Name | Fanconi anemia group F protein | |
| Gene Name | FANCF | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 374 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability (By similarity).. | |
| Protein Sequence | MESLLQHLDRFSELLAVSSTTYVSTWDPATVRRALQWARYLRHIHRRFGRHGPIRTALERRLHNQWRQEGGFGRGPVPGLANFQALGHCDVLLSLRLLENRALGDAARYHLVQQLFPGPGVRDADEETLQESLARLARRRSAVHMLRFNGYRENPNLQEDSLMKTQAELLLERLQEVGKAEAERPARFLSSLWERLPQNNFLKVIAVALLQPPLSRRPQEELEPGIHKSPGEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFRKRQVLGLSAGLSSV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 164 | Ubiquitination | LQEDSLMKTQAELLL CCCCHHHHHHHHHHH | 42.66 | 21906983 | |
| 179 | Ubiquitination | ERLQEVGKAEAERPA HHHHHHCHHHHHHHH | 48.51 | - | |
| 190 | Phosphorylation | ERPARFLSSLWERLP HHHHHHHHHHHHHCC | 22.22 | 22817900 | |
| 191 | Phosphorylation | RPARFLSSLWERLPQ HHHHHHHHHHHHCCC | 39.38 | 24260401 | |
| 322 | Ubiquitination | CQAPPPLKDKVLTAL HCCCCCCCHHHHHHH | 62.37 | - | |
| 324 | Ubiquitination | APPPLKDKVLTALET CCCCCCHHHHHHHHH | 37.24 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FANCF_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FANCF_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FANCF_HUMAN !! | ||||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| 603467 | Fanconi anemia complementation group F (FANCF) | |||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
