| UniProt ID | CENPX_HUMAN | |
|---|---|---|
| UniProt AC | A8MT69 | |
| Protein Name | Centromere protein X | |
| Gene Name | CENPX | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 81 | |
| Subcellular Localization | Nucleus . Chromosome, centromere . Chromosome, centromere, kinetochore . Assembly of CENPS and CENPX and its partner subunits CENPT and CENPW at centromeres occurs through a dynamic exchange mechanism. Although exchange is continuous in the cell cycl | |
| Protein Description | DNA-binding component of the Fanconi anemia (FA) core complex. Required for the normal activation of the FA pathway, leading to monoubiquitination of the FANCI-FANCD2 complex in response to DNA damage, cellular resistance to DNA cross-linking drugs, and prevention of chromosomal breakage. [PubMed: 20347428] | |
| Protein Sequence | MEGAGAGSGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 1 | Acetylation | -------MEGAGAGS -------CCCCCCCC | 10.93 | 22814378 | |
| 8 | Phosphorylation | MEGAGAGSGFRKELV CCCCCCCCHHHHHHH | 33.94 | - | |
| 16 | Phosphorylation | GFRKELVSRLLHLHF HHHHHHHHHHHHHHH | 29.81 | 22673903 | |
| 24 | Ubiquitination | RLLHLHFKDDKTKVS HHHHHHHCCCCCCCC | 55.03 | - | |
| 31 | Phosphorylation | KDDKTKVSGDALQLM CCCCCCCCHHHHHHH | 32.29 | 20068231 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CENPX_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CENPX_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CENPX_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| FANCL_HUMAN | FANCL | physical | 20347429 | |
| CENPS_HUMAN | APITD1 | physical | 20347429 | |
| FANCA_HUMAN | FANCA | physical | 20347429 | |
| FANCM_HUMAN | FANCM | physical | 20347429 | |
| MDM2_HUMAN | MDM2 | physical | 17347673 | |
| FANCM_HUMAN | FANCM | physical | 20347428 | |
| BLM_HUMAN | BLM | physical | 20347428 | |
| FANCA_HUMAN | FANCA | physical | 20347428 | |
| FP100_HUMAN | C17orf70 | physical | 20347428 | |
| RMI1_HUMAN | RMI1 | physical | 20347428 | |
| RFA1_HUMAN | RPA1 | physical | 20347428 | |
| FANCG_HUMAN | FANCG | physical | 20347428 | |
| FANCE_HUMAN | FANCE | physical | 20347428 | |
| FANCC_HUMAN | FANCC | physical | 20347428 | |
| FANCF_HUMAN | FANCF | physical | 20347428 | |
| RFA2_HUMAN | RPA2 | physical | 20347428 | |
| FAP24_HUMAN | C19orf40 | physical | 20347428 | |
| FANCL_HUMAN | FANCL | physical | 20347428 | |
| CENPS_HUMAN | APITD1 | physical | 20347428 | |
| CENPS_HUMAN | APITD1 | physical | 24699063 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
