| UniProt ID | FAP24_HUMAN | |
|---|---|---|
| UniProt AC | Q9BTP7 | |
| Protein Name | Fanconi anemia core complex-associated protein 24 {ECO:0000303|PubMed:17289582, ECO:0000312|HGNC:HGNC:28467} | |
| Gene Name | FAAP24 {ECO:0000303|PubMed:17289582, ECO:0000312|HGNC:HGNC:28467} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 215 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Plays a role in DNA repair through recruitment of the FA core complex to damaged DNA. Regulates FANCD2 monoubiquitination upon DNA damage. Induces chromosomal instability as well as hypersensitivity to DNA cross-linking agents, when repressed. Targets FANCM/FAAP24 complex to the DNA, preferentially to single strand DNA.. | |
| Protein Sequence | MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 9 | Phosphorylation | EKNPPDDTGPVHVPL CCCCCCCCCCCCCCC | 51.25 | 26270265 | |
| 97 | Phosphorylation | VVEKTRMSEQYFPAL EEEECCCCHHHCHHH | 20.46 | - | |
| 142 | Acetylation | EQTKEPSKNPLLGKK HHCCCCCCCCCCCHH | 73.61 | 7308137 | |
| 149 | Acetylation | KNPLLGKKRALLLSE CCCCCCHHHHHHHCC | 40.90 | 7308147 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAP24_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAP24_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAP24_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CLK2_HUMAN | CLK2 | physical | 18995830 | |
| FANCM_HUMAN | FANCM | physical | 18995830 | |
| ATR_HUMAN | ATR | physical | 18995830 | |
| ATRIP_HUMAN | ATRIP | physical | 18995830 | |
| FANCM_HUMAN | FANCM | physical | 17289582 | |
| FANCA_HUMAN | FANCA | physical | 17289582 | |
| FANCB_HUMAN | FANCB | physical | 17289582 | |
| FANCG_HUMAN | FANCG | physical | 17289582 | |
| FANCL_HUMAN | FANCL | physical | 17289582 | |
| A4_HUMAN | APP | physical | 21832049 | |
| FANCM_HUMAN | FANCM | physical | 20347428 | |
| CENPS_HUMAN | APITD1 | physical | 20347428 | |
| CENPX_HUMAN | STRA13 | physical | 20347428 | |
| FANCA_HUMAN | FANCA | physical | 20347428 | |
| FANCM_HUMAN | FANCM | physical | 28514442 | |
| TELO2_HUMAN | TELO2 | physical | 18995830 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...