UniProt ID | MI4GD_HUMAN | |
---|---|---|
UniProt AC | A9UHW6 | |
Protein Name | MIF4G domain-containing protein | |
Gene Name | MIF4GD | |
Organism | Homo sapiens (Human). | |
Sequence Length | 222 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Functions in replication-dependent translation of histone mRNAs which differ from other eukaryotic mRNAs in that they do not end with a poly-A tail but a stem-loop. May participate in circularizing those mRNAs specifically enhancing their translation.. | |
Protein Sequence | MGEPSREEYKIQSFDAETQQLLKTALKDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
10 | Ubiquitination | EPSREEYKIQSFDAE CCCHHHHCCCCCCHH | 37.23 | - | |
18 | Phosphorylation | IQSFDAETQQLLKTA CCCCCHHHHHHHHHH | 24.28 | - | |
23 | Ubiquitination | AETQQLLKTALKDPG HHHHHHHHHHHCCCC | 40.10 | - | |
27 | Ubiquitination | QLLKTALKDPGAVDL HHHHHHHCCCCCCCH | 60.45 | - | |
36 | Ubiquitination | PGAVDLEKVANVIVD CCCCCHHHHHHHHHC | 54.68 | - | |
53 | Acetylation | LQDCVFSKEAGRMCY HHHHHCCHHHHHHHH | 39.87 | 23749302 | |
53 | Malonylation | LQDCVFSKEAGRMCY HHHHHCCHHHHHHHH | 39.87 | 26320211 | |
53 | Ubiquitination | LQDCVFSKEAGRMCY HHHHHCCHHHHHHHH | 39.87 | - | |
68 | Ubiquitination | AIIQAESKQAGQSVF HHHHHHHHHHCHHHH | 35.36 | - | |
214 | Ubiquitination | KTTPAAHKYYYSEVS CCCCCHHHHHHCCCC | 30.16 | - | |
218 | Phosphorylation | AAHKYYYSEVSD--- CHHHHHHCCCCC--- | 18.52 | 28102081 | |
221 | Phosphorylation | KYYYSEVSD------ HHHHCCCCC------ | 33.29 | 27732954 | |
262 | Phosphorylation | ----------------------------------------------- ----------------------------------------------- | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MI4GD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MI4GD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MI4GD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
VIP1_HUMAN | PPIP5K1 | physical | 22939629 | |
PDXD1_HUMAN | PDXDC1 | physical | 22939629 | |
PPARG_HUMAN | PPARG | physical | 21988832 | |
CTIF_HUMAN | CTIF | physical | 26186194 | |
KLK3_HUMAN | KLK3 | physical | 26186194 | |
CTIF_HUMAN | CTIF | physical | 28514442 | |
KLK3_HUMAN | KLK3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...