KLK3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KLK3_HUMAN
• UniProt AC: P07288
• Protein Name: Prostate-specific antigen
• Gene Name: KLK3
• Organism: Homo sapiens (Human).
• Sequence Length: 261
• Subcellular Localization: Secreted.
• Protein Description: Hydrolyzes semenogelin-1 thus leading to the liquefaction of the seminal coagulum..
• Protein Sequence: MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERPSLYTKVVHYRKWIKDTIVANP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
69	N-linked_Glycosylation	TAAHCIRNKSVILLG HHHHHHHCCCEEEEE	22.50	10646852
69	N-linked_Glycosylation	TAAHCIRNKSVILLG HHHHHHHCCCEEEEE	22.50	10646852
104	Phosphorylation	PHPLYDMSLLKNRFL CCCCCCHHHHHCCCC	27.87	24719451
143	Phosphorylation	VKVMDLPTQEPALGT EEECCCCCCCCCCCC	53.51	18077418
167	Phosphorylation	IEPEEFLTPKKLQCV CCHHHHCCCCEEEEE	38.08	18077418
249	Phosphorylation	LYTKVVHYRKWIKDT HHEEHHHHHHHHHHC	11.41	22817900
251	Ubiquitination	TKVVHYRKWIKDTIV EEHHHHHHHHHHCEE	46.21	-
254	Ubiquitination	VHYRKWIKDTIVANP HHHHHHHHHCEECCC	47.94	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KLK3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KLK3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KLK3_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
A1AT_HUMAN	SERPINA1	physical	1702714
A2MG_HUMAN	A2M	physical	1702714
IPSP_HUMAN	SERPINA5	physical	7509746
IPSP_HUMAN	SERPINA5	physical	8665956
RL40_HUMAN	UBA52	physical	26186194
GRP78_HUMAN	HSPA5	physical	26186194
ANDR_HUMAN	AR	physical	25241761
A2MG_HUMAN	A2M	physical	25241761
FINC_HUMAN	FN1	physical	25241761
RL40_HUMAN	UBA52	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.