RMI2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RMI2_HUMAN
• UniProt AC: Q96E14
• Protein Name: RecQ-mediated genome instability protein 2
• Gene Name: RMI2
• Organism: Homo sapiens (Human).
• Sequence Length: 147
• Subcellular Localization: Nucleus . Colocalizes with BLM at nuclear DNA repair foci.
• Protein Description: Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates. It is required to regulate sister chromatid segregation and to limit DNA crossover. Essential for the stability, localization, and function of BLM, TOP3A, and complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM..
• Protein Sequence: MAAAADSFSGGPAGVRLPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAAADSFS ------CCCCCCCCC	13.05	22814378
7	Phosphorylation	-MAAAADSFSGGPAG -CCCCCCCCCCCCCC	19.31	25159151
9	Phosphorylation	AAAADSFSGGPAGVR CCCCCCCCCCCCCCC	46.95	29514088
16	Methylation	SGGPAGVRLPRSPPL CCCCCCCCCCCCCCH	37.75	115491321
20	Phosphorylation	AGVRLPRSPPLKVLA CCCCCCCCCCHHHHH	29.00	22199227
24	Ubiquitination	LPRSPPLKVLAEQLR CCCCCCHHHHHHHHH	40.76	-
31	Methylation	KVLAEQLRRDAEGGP HHHHHHHHHHCCCCC	33.84	115491329
42	Methylation	EGGPGAWRLSRAAAG CCCCCHHHHHHHHCC	23.42	24381635
84	Methylation	PSGDFSVRGLERVPR CCCCCCCCCCEECCC	42.66	115491325
112	Phosphorylation	MGVVQACSPEPCLQA EEEEECCCCHHHHHH	35.00	27251275

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
112	S	Phosphorylation	Kinase	TTK	P33981	PSP

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RMI2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RMI2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TOP3A_HUMAN	TOP3A	physical	26186194
RMI1_HUMAN	RMI1	physical	26186194
BLM_HUMAN	BLM	physical	26186194
RMI1_HUMAN	RMI1	physical	28514442
TOP3A_HUMAN	TOP3A	physical	28514442
BLM_HUMAN	BLM	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.