S100B_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: S100B_HUMAN
• UniProt AC: P04271
• Protein Name: Protein S100-B
• Gene Name: S100B
• Organism: Homo sapiens (Human).
• Sequence Length: 92
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity..
• Protein Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Blocked amino end (Ser)	------MSELEKAMV ------CHHHHHHHH	51.38	-
2	Acetylation	------MSELEKAMV ------CHHHHHHHH	51.38	-
2	Blocked amino end	------MSELEKAMV ------CHHHHHHHH	51.38	4031854
85	S-nitrosocysteine	VAMVTTACHEFFEHE HHHHHHHHHHHHCCC	2.72	-
85	S-nitrosylation	VAMVTTACHEFFEHE HHHHHHHHHHHHCCC	2.72	22178444

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of S100B_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of S100B_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of S100B_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
P53_HUMAN	TP53	physical	15178678
IQGA1_HUMAN	IQGAP1	physical	12377780
S100B_HUMAN	S100B	physical	10913138
S10AB_HUMAN	S100A11	physical	10913138
S10A1_HUMAN	S100A1	physical	10913138
S10A6_HUMAN	S100A6	physical	10913138
CAZA1_HUMAN	CAPZA1	physical	12470955
TAU_HUMAN	MAPT	physical	11264299
VAV_HUMAN	VAV1	physical	10394361
PGM1_HUMAN	PGM1	physical	8894274
AHNK_HUMAN	AHNAK	physical	11312263
NDRG1_HUMAN	NDRG1	physical	12493777
S100B_HUMAN	S100B	physical	9925766
S10A1_HUMAN	S100A1	physical	9925766
S10A6_HUMAN	S100A6	physical	9925766
TAU_HUMAN	MAPT	physical	2833519
S100B_HUMAN	S100B	physical	9519411
STK38_HUMAN	STK38	physical	9774336
S100B_HUMAN	S100B	physical	25416956
S100P_HUMAN	S100P	physical	25416956
SPG21_HUMAN	SPG21	physical	25416956
DJC30_HUMAN	DNAJC30	physical	21516116
ADTRP_HUMAN	ADTRP	physical	21516116
IMP4_HUMAN	IMP4	physical	21516116
S10A4_HUMAN	S100A4	physical	26496610
S100P_HUMAN	S100P	physical	26496610
SRC_HUMAN	SRC	physical	19147496

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• DB00768: Olopatadine