| UniProt ID | S10A1_HUMAN | |
|---|---|---|
| UniProt AC | P23297 | |
| Protein Name | Protein S100-A1 | |
| Gene Name | S100A1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 94 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Probably acts as a Ca(2+) signal transducer. [PubMed: 22399290 In response to an increase in intracellular Ca(2+) levels, binds calcium which triggers a conformational change] | |
| Protein Sequence | MGSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAALTVACNNFFWENS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 27 | Phosphorylation | SGKEGDKYKLSKKEL CCCCCCCCCCCHHHH | 23.15 | - | |
| 43 | Phosphorylation | ELLQTELSGFLDAQK HHHHHHHHHHHHHHH | 22.67 | 28348404 | |
| 86 | S-nitrosocysteine | VAALTVACNNFFWEN HHHHHHHHHHHHCCC | 3.58 | - | |
| 86 | S-nitrosylation | VAALTVACNNFFWEN HHHHHHHHHHHHCCC | 3.58 | 22989881 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of S10A1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| S100P_HUMAN | S100P | physical | 16189514 | |
| S10A1_HUMAN | S100A1 | physical | 16189514 | |
| NIF3L_HUMAN | NIF3L1 | physical | 16189514 | |
| S100B_HUMAN | S100B | physical | 16189514 | |
| S10A4_HUMAN | S100A4 | physical | 16189514 | |
| PYGM_HUMAN | PYGM | physical | 12804600 | |
| CXA1_HUMAN | GJA1 | physical | 12804600 | |
| AT2A2_HUMAN | ATP2A2 | physical | 12804600 | |
| PLB1_HUMAN | PLB1 | physical | 12804600 | |
| PGM1_HUMAN | PGM1 | physical | 8894274 | |
| S10A1_HUMAN | S100A1 | physical | 9803314 | |
| S10A4_HUMAN | S100A4 | physical | 10753920 | |
| RYR1_HUMAN | RYR1 | physical | 9298970 | |
| S10A1_HUMAN | S100A1 | physical | 25416956 | |
| S10A2_HUMAN | S100A2 | physical | 25416956 | |
| S100B_HUMAN | S100B | physical | 25416956 | |
| PKHF2_HUMAN | PLEKHF2 | physical | 25416956 | |
| S100B_HUMAN | S100B | physical | 21516116 |
| Kegg Disease | |
|---|---|
| There are no disease associations of PTM sites. | |
| OMIM Disease | |
| There are no disease associations of PTM sites. | |
| Kegg Drug | |
| There are no disease associations of PTM sites. | |
| DrugBank | |
| DB00768 | Olopatadine |
loading...
