| UniProt ID | S10A2_HUMAN | |
|---|---|---|
| UniProt AC | P29034 | |
| Protein Name | Protein S100-A2 | |
| Gene Name | S100A2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 98 | |
| Subcellular Localization | ||
| Protein Description | May function as calcium sensor and modulator, contributing to cellular calcium signaling. May function by interacting with other proteins, such as TPR-containing proteins, and indirectly play a role in many physiological processes. May also play a role in suppressing tumor cell growth.. | |
| Protein Sequence | MMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MMCSSLEQAL -----CCCCHHHHHH | 2.11 | 24719451 | |
| 4 | Phosphorylation | ----MMCSSLEQALA ----CCCCHHHHHHH | 21.77 | 24719451 | |
| 5 | Phosphorylation | ---MMCSSLEQALAV ---CCCCHHHHHHHH | 30.88 | 28348404 | |
| 20 | Phosphorylation | LVTTFHKYSCQEGDK HHHHHHHHCCCCCCC | 13.20 | 26267517 | |
| 26 | Acetylation | KYSCQEGDKFKLSKG HHCCCCCCCEECCHH | 53.09 | - | |
| 27 | Acetylation | YSCQEGDKFKLSKGE HCCCCCCCEECCHHH | 56.08 | 26210075 | |
| 32 | Ubiquitination | GDKFKLSKGEMKELL CCCEECCHHHHHHHH | 70.13 | - | |
| 35 | Ubiquitination | FKLSKGEMKELLHKE EECCHHHHHHHHHHH | 5.80 | 23000965 | |
| 40 | Ubiquitination | GEMKELLHKELPSFV HHHHHHHHHHCHHHH | 33.88 | 23000965 | |
| 40 | Acetylation | GEMKELLHKELPSFV HHHHHHHHHHCHHHH | 33.88 | - | |
| 41 | Acetylation | EMKELLHKELPSFVG HHHHHHHHHCHHHHC | 62.00 | 22424773 | |
| 41 | Ubiquitination | EMKELLHKELPSFVG HHHHHHHHHCHHHHC | 62.00 | - | |
| 49 | Ubiquitination | ELPSFVGEKVDEEGL HCHHHHCCCCCHHHH | 44.60 | - | |
| 62 | Phosphorylation | GLKKLMGSLDENSDQ HHHHHHCCCCCCCCC | 20.77 | - | |
| 67 | Phosphorylation | MGSLDENSDQQVDFQ HCCCCCCCCCCCCHH | 34.45 | - |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S10A2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S10A2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| S10A2_HUMAN | S100A2 | physical | 16189514 | |
| S10A2_HUMAN | S100A2 | physical | 10951287 | |
| CHIP_HUMAN | STUB1 | physical | 23344957 | |
| S10A2_HUMAN | S100A2 | physical | 25416956 | |
| S100B_HUMAN | S100B | physical | 25416956 | |
| HOP_HUMAN | HOPX | physical | 24556685 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...