HOP_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HOP_HUMAN
• UniProt AC: Q9BPY8
• Protein Name: Homeodomain-only protein
• Gene Name: HOPX
• Organism: Homo sapiens (Human).
• Sequence Length: 73
• Subcellular Localization: Nucleus . Cytoplasm .
• Protein Description: Atypical homeodomain protein which does not bind DNA and is required to modulate cardiac growth and development. Acts via its interaction with SRF, thereby modulating the expression of SRF-dependent cardiac-specific genes and cardiac development. Prevents SRF-dependent transcription either by inhibiting SRF binding to DNA or by recruiting histone deacetylase (HDAC) proteins that prevent transcription by SRF. Overexpression causes cardiac hypertrophy (By similarity). May act as a tumor suppressor. Acts as a co-chaperone for HSPA1A and HSPA1B chaperone proteins and assists in chaperone-mediated protein refolding. [PubMed: 27708256]
• Protein Sequence: MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRSVTD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
7	Phosphorylation	-MSAETASGPTEDQV -CCCCCCCCCCHHHH	53.37	27251275
10	Phosphorylation	AETASGPTEDQVEIL CCCCCCCCHHHHHHH	56.57	27251275
30	Phosphorylation	KVDKHPDSTTLCLIA CCCCCCCHHHHHHHH	27.95	27251275
31	Phosphorylation	VDKHPDSTTLCLIAA CCCCCCHHHHHHHHH	31.03	27251275
32	Phosphorylation	DKHPDSTTLCLIAAE CCCCCHHHHHHHHHH	21.30	27251275
48	Phosphorylation	GLSEEETQKWFKQRL CCCHHHHHHHHHHHH	44.24	27251275
61	Phosphorylation	RLAKWRRSEGLPSEC HHHHHHHHCCCCHHH	27.69	27499020
66	Phosphorylation	RRSEGLPSECRSVTD HHHCCCCHHHCCCCC	55.13	24702127
70	Phosphorylation	GLPSECRSVTD---- CCCHHHCCCCC----	40.82	29978859
72	Phosphorylation	PSECRSVTD------ CHHHCCCCC------	36.92	33259812
79	Phosphorylation	TD------------- CC-------------		27251275
84	Phosphorylation	------------------ ------------------		27251275
88	Phosphorylation	---------------------- ----------------------		27251275
90	Phosphorylation	------------------------ ------------------------		33259812

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HOP_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HOP_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HOP_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HDAC2_HUMAN	HDAC2	physical	12975471
ZSCA1_HUMAN	ZSCAN1	physical	20211142
INT13_HUMAN	ASUN	physical	28514442

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.