UniProt ID | S100P_HUMAN | |
---|---|---|
UniProt AC | P25815 | |
Protein Name | Protein S100-P | |
Gene Name | S100P | |
Organism | Homo sapiens (Human). | |
Sequence Length | 95 | |
Subcellular Localization | Nucleus. Cytoplasm. Cell projection, microvillus membrane. Colocalizes with S100PBP in the nucleus. Colocolizes with EZR in the microvilli in a calcium-dependent manner. | |
Protein Description | May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).. | |
Protein Sequence | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTELETAMG ------CCHHHHHHH | 49.64 | 21060948 | |
6 | Phosphorylation | --MTELETAMGMIID --CCHHHHHHHHHHH | 34.27 | 25072903 | |
16 | Phosphorylation | GMIIDVFSRYSGSEG HHHHHHHHHCCCCCC | 30.11 | 25072903 | |
18 | Phosphorylation | IIDVFSRYSGSEGST HHHHHHHCCCCCCCC | 19.04 | 20068231 | |
19 | Phosphorylation | IDVFSRYSGSEGSTQ HHHHHHCCCCCCCCE | 34.43 | 20068231 | |
21 | Phosphorylation | VFSRYSGSEGSTQTL HHHHCCCCCCCCEEE | 32.61 | 26657352 | |
24 | Phosphorylation | RYSGSEGSTQTLTKG HCCCCCCCCEEECHH | 17.19 | 25159151 | |
25 | Phosphorylation | YSGSEGSTQTLTKGE CCCCCCCCEEECHHH | 36.11 | 28450419 | |
27 | Phosphorylation | GSEGSTQTLTKGELK CCCCCCEEECHHHHH | 36.16 | 28450419 | |
29 | Phosphorylation | EGSTQTLTKGELKVL CCCCEEECHHHHHHH | 40.15 | 20068231 | |
30 | Ubiquitination | GSTQTLTKGELKVLM CCCEEECHHHHHHHH | 54.20 | 21963094 | |
30 | Acetylation | GSTQTLTKGELKVLM CCCEEECHHHHHHHH | 54.20 | 26051181 | |
34 | Acetylation | TLTKGELKVLMEKEL EECHHHHHHHHHCCC | 29.08 | 27452117 | |
34 | Ubiquitination | TLTKGELKVLMEKEL EECHHHHHHHHHCCC | 29.08 | 22817900 | |
39 | Succinylation | ELKVLMEKELPGFLQ HHHHHHHCCCCCHHH | 51.06 | 23954790 | |
39 | Acetylation | ELKVLMEKELPGFLQ HHHHHHHCCCCCHHH | 51.06 | 26051181 | |
39 | Ubiquitination | ELKVLMEKELPGFLQ HHHHHHHCCCCCHHH | 51.06 | 33845483 | |
49 | Ubiquitination | PGFLQSGKDKDAVDK CCHHHCCCCHHHHHH | 67.84 | 29967540 | |
49 | Acetylation | PGFLQSGKDKDAVDK CCHHHCCCCHHHHHH | 67.84 | 27452117 | |
49 | Succinylation | PGFLQSGKDKDAVDK CCHHHCCCCHHHHHH | 67.84 | 23954790 | |
56 | Ubiquitination | KDKDAVDKLLKDLDA CCHHHHHHHHHHHCC | 49.47 | 29967540 | |
91 | Ubiquitination | ACHKYFEKAGLK--- HHHHHHHHCCCC--- | 37.54 | 33845483 | |
91 | Acetylation | ACHKYFEKAGLK--- HHHHHHHHCCCC--- | 37.54 | 27178108 |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of S100P_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of S100P_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
S100P_HUMAN | S100P | physical | 10924150 | |
RAGE_HUMAN | AGER | physical | 14617629 | |
EZRI_HUMAN | EZR | physical | 12808036 | |
S100Z_HUMAN | S100Z | physical | 11747429 | |
S100P_HUMAN | S100P | physical | 1633809 | |
S100P_HUMAN | S100P | physical | 12507480 | |
SGT1_HUMAN | SUGT1 | physical | 22939629 | |
CHIP_HUMAN | STUB1 | physical | 23344957 | |
TFP11_HUMAN | TFIP11 | physical | 25416956 |
Kegg Disease | |
---|---|
There are no disease associations of PTM sites. | |
OMIM Disease | |
There are no disease associations of PTM sites. | |
Kegg Drug | |
There are no disease associations of PTM sites. | |
DrugBank | |
DB01003 | Cromoglicic acid |
loading...