UniProt ID | NH2L1_HUMAN | |
---|---|---|
UniProt AC | P55769 | |
Protein Name | NHP2-like protein 1 | |
Gene Name | SNU13 {ECO:0000312|HGNC:HGNC:7819} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 128 | |
Subcellular Localization | Nucleus . Nucleus, nucleolus . Concentrated in the dense fibrillar component of the nucleolus. | |
Protein Description | Involved in pre-mRNA splicing as component of the spliceosome. [PubMed: 28781166 Binds to the 5'-stem-loop of U4 snRNA and thereby contributes to spliceosome assembly] | |
Protein Sequence | MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MTEADVNP -------CCCCCCCC | 7.44 | 19413330 | |
2 | Acetylation | ------MTEADVNPK ------CCCCCCCCC | 39.62 | 25944712 | |
9 | Ubiquitination | TEADVNPKAYPLADA CCCCCCCCHHCHHHH | 56.18 | - | |
9 | 2-Hydroxyisobutyrylation | TEADVNPKAYPLADA CCCCCCCCHHCHHHH | 56.18 | - | |
11 | Nitration | ADVNPKAYPLADAHL CCCCCCHHCHHHHHH | 12.61 | - | |
11 | Phosphorylation | ADVNPKAYPLADAHL CCCCCCHHCHHHHHH | 12.61 | 28152594 | |
20 | Ubiquitination | LADAHLTKKLLDLVQ HHHHHHHHHHHHHHH | 48.02 | - | |
20 | Malonylation | LADAHLTKKLLDLVQ HHHHHHHHHHHHHHH | 48.02 | 26320211 | |
20 | 2-Hydroxyisobutyrylation | LADAHLTKKLLDLVQ HHHHHHHHHHHHHHH | 48.02 | - | |
20 | Acetylation | LADAHLTKKLLDLVQ HHHHHHHHHHHHHHH | 48.02 | 25953088 | |
21 | Malonylation | ADAHLTKKLLDLVQQ HHHHHHHHHHHHHHH | 49.39 | 26320211 | |
21 | Acetylation | ADAHLTKKLLDLVQQ HHHHHHHHHHHHHHH | 49.39 | 23954790 | |
21 | Sumoylation | ADAHLTKKLLDLVQQ HHHHHHHHHHHHHHH | 49.39 | - | |
21 | Ubiquitination | ADAHLTKKLLDLVQQ HHHHHHHHHHHHHHH | 49.39 | - | |
21 | Sumoylation | ADAHLTKKLLDLVQQ HHHHHHHHHHHHHHH | 49.39 | - | |
29 | Phosphorylation | LLDLVQQSCNYKQLR HHHHHHHHCCHHHHH | 6.29 | 20068231 | |
30 | S-nitrosylation | LDLVQQSCNYKQLRK HHHHHHHCCHHHHHH | 5.84 | 19483679 | |
30 | Glutathionylation | LDLVQQSCNYKQLRK HHHHHHHCCHHHHHH | 5.84 | 22555962 | |
30 | S-nitrosocysteine | LDLVQQSCNYKQLRK HHHHHHHCCHHHHHH | 5.84 | - | |
32 | Phosphorylation | LVQQSCNYKQLRKGA HHHHHCCHHHHHHHH | 12.39 | 20090780 | |
33 | Methylation | VQQSCNYKQLRKGAN HHHHCCHHHHHHHHH | 28.94 | 23583077 | |
33 | 2-Hydroxyisobutyrylation | VQQSCNYKQLRKGAN HHHHCCHHHHHHHHH | 28.94 | - | |
33 | Ubiquitination | VQQSCNYKQLRKGAN HHHHCCHHHHHHHHH | 28.94 | 21890473 | |
33 | Acetylation | VQQSCNYKQLRKGAN HHHHCCHHHHHHHHH | 28.94 | 25953088 | |
37 | Ubiquitination | CNYKQLRKGANEATK CCHHHHHHHHHHHHH | 71.60 | - | |
44 | 2-Hydroxyisobutyrylation | KGANEATKTLNRGIS HHHHHHHHHHHHHHH | 59.05 | - | |
44 | Ubiquitination | KGANEATKTLNRGIS HHHHHHHHHHHHHHH | 59.05 | 21890473 | |
44 | Acetylation | KGANEATKTLNRGIS HHHHHHHHHHHHHHH | 59.05 | 25953088 | |
51 | Phosphorylation | KTLNRGISEFIVMAA HHHHHHHHHEEEEEC | 29.31 | 22210691 | |
86 | 2-Hydroxyisobutyrylation | PYVFVRSKQALGRAC CEEEEECHHHHHHHC | 29.09 | - | |
96 | Phosphorylation | LGRACGVSRPVIACS HHHHCCCCCCEEEEE | 19.02 | 20068231 | |
102 | Glutathionylation | VSRPVIACSVTIKEG CCCCEEEEEEEECCC | 2.00 | 22555962 | |
103 | Phosphorylation | SRPVIACSVTIKEGS CCCEEEEEEEECCCH | 17.17 | 20068231 | |
105 | Phosphorylation | PVIACSVTIKEGSQL CEEEEEEEECCCHHH | 15.27 | 20068231 | |
107 | Ubiquitination | IACSVTIKEGSQLKQ EEEEEEECCCHHHHH | 46.81 | - | |
107 | Acetylation | IACSVTIKEGSQLKQ EEEEEEECCCHHHHH | 46.81 | 25953088 | |
113 | Acetylation | IKEGSQLKQQIQSIQ ECCCHHHHHHHHHHH | 32.30 | 25953088 | |
113 | Ubiquitination | IKEGSQLKQQIQSIQ ECCCHHHHHHHHHHH | 32.30 | 2190698 | |
118 | Phosphorylation | QLKQQIQSIQQSIER HHHHHHHHHHHHHHH | 24.80 | 30266825 | |
122 | Phosphorylation | QIQSIQQSIERLLV- HHHHHHHHHHHHCC- | 15.27 | 23401153 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NH2L1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NH2L1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NH2L1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...