UniProt ID | NOP16_HUMAN | |
---|---|---|
UniProt AC | Q9Y3C1 | |
Protein Name | Nucleolar protein 16 | |
Gene Name | NOP16 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 178 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | ||
Protein Sequence | MPKAKGKTRRQKFGYSVNRKRLNRNARRKAAPRIECSHIRHAWDHAKSVRQNLAEMGLAVDPNRAVPLRKRKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVRYMVENHGEDYKAMARDEKNYYQDTPKQIRSKINVYKRFYPAEWQDFLDSLQKRKMEVE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
8 | Phosphorylation | MPKAKGKTRRQKFGY CCCCCCCCCHHHHCC | 39.49 | 21406692 | |
12 | Ubiquitination | KGKTRRQKFGYSVNR CCCCCHHHHCCCCCH | 38.66 | - | |
15 | Phosphorylation | TRRQKFGYSVNRKRL CCHHHHCCCCCHHHH | 16.75 | 28152594 | |
16 | Phosphorylation | RRQKFGYSVNRKRLN CHHHHCCCCCHHHHC | 17.19 | 25159151 | |
47 | 2-Hydroxyisobutyrylation | RHAWDHAKSVRQNLA HHHHHHHHHHHHHHH | 46.17 | - | |
47 | Acetylation | RHAWDHAKSVRQNLA HHHHHHHHHHHHHHH | 46.17 | 26822725 | |
47 | Ubiquitination | RHAWDHAKSVRQNLA HHHHHHHHHHHHHHH | 46.17 | - | |
48 | Phosphorylation | HAWDHAKSVRQNLAE HHHHHHHHHHHHHHH | 24.26 | 26434776 | |
74 | Sumoylation | PLRKRKVKAMEVDIE CCCCCCCCEEECCHH | 45.08 | 28112733 | |
76 | Sulfoxidation | RKRKVKAMEVDIEER CCCCCCEEECCHHHC | 4.23 | 21406390 | |
77 | Acetylation | KRKVKAMEVDIEERP CCCCCEEECCHHHCC | 41.73 | 19608861 | |
90 | Ubiquitination | RPKELVRKPYVLNDL CCHHHHCCCCCCCCH | 32.97 | 19608861 | |
90 | Acetylation | RPKELVRKPYVLNDL CCHHHHCCCCCCCCH | 32.97 | 19608861 | |
92 | Phosphorylation | KELVRKPYVLNDLEA HHHHCCCCCCCCHHH | 22.17 | 28152594 | |
102 | Phosphorylation | NDLEAEASLPEKKGN CCHHHHHCCCCCCCC | 35.64 | 28450419 | |
106 | Ubiquitination | AEASLPEKKGNTLSR HHHCCCCCCCCCCCH | 65.13 | - | |
106 | Acetylation | AEASLPEKKGNTLSR HHHCCCCCCCCCCCH | 65.13 | 26051181 | |
106 | 2-Hydroxyisobutyrylation | AEASLPEKKGNTLSR HHHCCCCCCCCCCCH | 65.13 | - | |
112 | Phosphorylation | EKKGNTLSRDLIDYV CCCCCCCCHHHHHHH | 23.01 | 29214152 | |
130 | Phosphorylation | VENHGEDYKAMARDE HHHCCHHHHHHHHHC | 9.06 | - | |
131 | Acetylation | ENHGEDYKAMARDEK HHCCHHHHHHHHHCC | 43.96 | 26051181 | |
134 (in isoform 2) | Ubiquitination | - | 22.19 | - | |
135 | Ubiquitination | EDYKAMARDEKNYYQ HHHHHHHHHCCCCCC | 39.27 | - | |
138 | 2-Hydroxyisobutyrylation | KAMARDEKNYYQDTP HHHHHHCCCCCCCCH | 55.31 | - | |
138 | Acetylation | KAMARDEKNYYQDTP HHHHHHCCCCCCCCH | 55.31 | 26051181 | |
140 | Phosphorylation | MARDEKNYYQDTPKQ HHHHCCCCCCCCHHH | 17.36 | 27174698 | |
141 | Phosphorylation | ARDEKNYYQDTPKQI HHHCCCCCCCCHHHH | 14.87 | 27174698 | |
144 | Phosphorylation | EKNYYQDTPKQIRSK CCCCCCCCHHHHHHH | 19.50 | 25159151 | |
146 | Malonylation | NYYQDTPKQIRSKIN CCCCCCHHHHHHHHH | 61.52 | 26320211 | |
146 | Acetylation | NYYQDTPKQIRSKIN CCCCCCHHHHHHHHH | 61.52 | 26051181 | |
146 | Ubiquitination | NYYQDTPKQIRSKIN CCCCCCHHHHHHHHH | 61.52 | - | |
169 | Phosphorylation | EWQDFLDSLQKRKME HHHHHHHHHHHHHHC | 34.54 | 22199227 | |
216 (in isoform 3) | Phosphorylation | - | 28674419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOP16_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOP16_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOP16_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
HERC5_HUMAN | HERC5 | physical | 28514442 | |
NP1L1_HUMAN | NAP1L1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions."; Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.; Science 325:834-840(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-90, AND MASS SPECTROMETRY. | |
Phosphorylation | |
Reference | PubMed |
"A quantitative atlas of mitotic phosphorylation."; Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.; Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-16 AND THR-144, AND MASSSPECTROMETRY. |