UniProt ID | SPF27_HUMAN | |
---|---|---|
UniProt AC | O75934 | |
Protein Name | Pre-mRNA-splicing factor SPF27 | |
Gene Name | BCAS2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 225 | |
Subcellular Localization | Nucleus, nucleolus . | |
Protein Description | Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR).. | |
Protein Sequence | MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAGTGLVAG ------CCCCCCCCC | 25.01 | 22814378 | |
4 | Phosphorylation | ----MAGTGLVAGEV ----CCCCCCCCCEE | 20.15 | 18491316 | |
23 | Phosphorylation | LPYFDQGYEAPGVRE CCCCCCCCCCCCHHH | 11.86 | - | |
47 | Acetylation | TRRYRPTKNYLSYLT HHHHCCCCCHHHHHC | 46.40 | 26051181 | |
47 | Ubiquitination | TRRYRPTKNYLSYLT HHHHCCCCCHHHHHC | 46.40 | - | |
59 | Phosphorylation | YLTAPDYSAFETDIM HHCCCCCCHHHHHHH | 33.58 | - | |
83 | Phosphorylation | RQPIELLSMKRYELP CCCHHHHHCEEEECC | 34.58 | 20068231 | |
85 | Ubiquitination | PIELLSMKRYELPAP CHHHHHCEEEECCCC | 48.75 | - | |
87 | Phosphorylation | ELLSMKRYELPAPSS HHHHCEEEECCCCCC | 19.12 | 28796482 | |
93 | Phosphorylation | RYELPAPSSGQKNDI EEECCCCCCCCCCCH | 49.56 | 20068231 | |
94 | Phosphorylation | YELPAPSSGQKNDIT EECCCCCCCCCCCHH | 44.15 | 25159151 | |
97 | Ubiquitination | PAPSSGQKNDITAWQ CCCCCCCCCCHHHHH | 61.18 | - | |
136 | Ubiquitination | QHGCNAWKVYNENLV HCCCCCHHHHHHHHH | 32.22 | - | |
136 | Acetylation | QHGCNAWKVYNENLV HCCCCCHHHHHHHHH | 32.22 | 25953088 | |
151 | Acetylation | HMIEHAQKELQKLRK HHHHHHHHHHHHHHH | 62.26 | 27452117 | |
158 | Acetylation | KELQKLRKHIQDLNW HHHHHHHHHHHHHHH | 56.34 | 27452117 | |
158 | Ubiquitination | KELQKLRKHIQDLNW HHHHHHHHHHHHHHH | 56.34 | - | |
168 | Ubiquitination | QDLNWQRKNMQLTAG HHHHHHHHHCCCCCC | 41.49 | - | |
173 | Phosphorylation | QRKNMQLTAGSKLRE HHHHCCCCCCHHHHH | 16.45 | 21406692 | |
176 | Phosphorylation | NMQLTAGSKLREMES HCCCCCCHHHHHHHH | 26.50 | 21406692 | |
177 | Acetylation | MQLTAGSKLREMESN CCCCCCHHHHHHHHH | 51.12 | 25953088 | |
177 | Ubiquitination | MQLTAGSKLREMESN CCCCCCHHHHHHHHH | 51.12 | - | |
183 | Phosphorylation | SKLREMESNWVSLVS HHHHHHHHHHHHHHH | 34.38 | 24260401 | |
187 | Phosphorylation | EMESNWVSLVSKNYE HHHHHHHHHHHCCCE | 18.05 | 29759185 | |
190 | Phosphorylation | SNWVSLVSKNYEIER HHHHHHHHCCCEEEE | 22.07 | 29759185 | |
191 | Ubiquitination | NWVSLVSKNYEIERT HHHHHHHCCCEEEEE | 56.95 | - | |
193 | Phosphorylation | VSLVSKNYEIERTIV HHHHHCCCEEEEEEE | 23.24 | 25219547 | |
198 | Phosphorylation | KNYEIERTIVQLENE CCCEEEEEEEHHHHH | 16.83 | 27174698 | |
207 | Phosphorylation | VQLENEIYQIKQQHG EHHHHHHHHHHHHHC | 9.67 | 25219547 | |
210 | Ubiquitination | ENEIYQIKQQHGEAN HHHHHHHHHHHCHHC | 28.51 | 21906983 | |
218 | Ubiquitination | QQHGEANKENIRQDF HHHCHHCHHHHHHCC | 60.22 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of SPF27_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of SPF27_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of SPF27_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Acetylation | |
Reference | PubMed |
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach."; Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.; Anal. Chem. 81:4493-4501(2009). Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY. |