| UniProt ID | RRP7A_HUMAN | |
|---|---|---|
| UniProt AC | Q9Y3A4 | |
| Protein Name | Ribosomal RNA-processing protein 7 homolog A | |
| Gene Name | RRP7A | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 280 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MVARRRKCAARDPEDRIPSPLGYAAIPIKFSEKQQASHYLYVRAHGVRQGTKSTWPQKRTLFVLNVPPYCTEESLSRLLSTCGLVQSVELQEKPDLAESPKESRSKFFHPKPVPGFQVAYVVFQKPSGVSAALALKGPLLVSTESHPVKSGIHKWISDYADSVPDPEALRVEVDTFMEAYDQKIAEEEAKAKEEEGVPDEEGWVKVTRRGRRPVLPRTEAASLRVLERERRKRSRKELLNFYAWQHRESKMEHLAQLRKKFEEDKQRIELLRAQRKFRPY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 7 | Methylation | -MVARRRKCAARDPE -CCCCCCCHHCCCHH | 26.81 | 116254053 | |
| 19 | Phosphorylation | DPEDRIPSPLGYAAI CHHHCCCCCCCEEEE | 30.31 | 30266825 | |
| 23 | Phosphorylation | RIPSPLGYAAIPIKF CCCCCCCEEEEEEEC | 10.67 | 20068231 | |
| 29 | Ubiquitination | GYAAIPIKFSEKQQA CEEEEEEECCHHHCC | 37.17 | 22817900 | |
| 31 | Phosphorylation | AAIPIKFSEKQQASH EEEEEECCHHHCCCE | 38.59 | 24719451 | |
| 33 | Ubiquitination | IPIKFSEKQQASHYL EEEECCHHHCCCEEE | 46.65 | 21963094 | |
| 58 | Ubiquitination | TKSTWPQKRTLFVLN CCCCCCCCEEEEEEC | 43.18 | - | |
| 80 | Phosphorylation | ESLSRLLSTCGLVQS HHHHHHHHHHCCCCE | 26.66 | 24732914 | |
| 81 | Phosphorylation | SLSRLLSTCGLVQSV HHHHHHHHHCCCCEE | 15.57 | 24732914 | |
| 87 | Phosphorylation | STCGLVQSVELQEKP HHHCCCCEEECHHCC | 15.30 | 24732914 | |
| 93 | Acetylation | QSVELQEKPDLAESP CEEECHHCCCHHCCC | 30.76 | 26051181 | |
| 93 | Ubiquitination | QSVELQEKPDLAESP CEEECHHCCCHHCCC | 30.76 | 21963094 | |
| 99 | Phosphorylation | EKPDLAESPKESRSK HCCCHHCCCHHHHHH | 35.35 | 29255136 | |
| 101 | Ubiquitination | PDLAESPKESRSKFF CCHHCCCHHHHHHCC | 77.06 | 29967540 | |
| 103 | Phosphorylation | LAESPKESRSKFFHP HHCCCHHHHHHCCCC | 48.24 | 28387310 | |
| 149 | Ubiquitination | STESHPVKSGIHKWI ECCCCCCCCHHHHHH | 47.63 | 21906983 | |
| 154 | Ubiquitination | PVKSGIHKWISDYAD CCCCHHHHHHHHHHH | 44.28 | 22817900 | |
| 183 | Sumoylation | FMEAYDQKIAEEEAK HHHHHHHHHHHHHHH | 40.77 | - | |
| 183 | Ubiquitination | FMEAYDQKIAEEEAK HHHHHHHHHHHHHHH | 40.77 | 21963094 | |
| 192 | Sumoylation | AEEEAKAKEEEGVPD HHHHHHHHHHHCCCC | 66.02 | - | |
| 192 | Ubiquitination | AEEEAKAKEEEGVPD HHHHHHHHHHHCCCC | 66.02 | 29967540 | |
| 192 | Sumoylation | AEEEAKAKEEEGVPD HHHHHHHHHHHCCCC | 66.02 | - | |
| 205 | Ubiquitination | PDEEGWVKVTRRGRR CCCCCCEEEEECCCC | 31.23 | 29967540 | |
| 250 | Ubiquitination | AWQHRESKMEHLAQL HHHHHHHHHHHHHHH | 43.48 | 21890473 | |
| 260 | Ubiquitination | HLAQLRKKFEEDKQR HHHHHHHHHHHHHHH | 52.12 | 24816145 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RRP7A_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RRP7A_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RRP7A_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| U2AF2_HUMAN | U2AF2 | physical | 22939629 | |
| U2AF1_HUMAN | U2AF1 | physical | 22939629 | |
| TPR_HUMAN | TPR | physical | 22939629 | |
| ATP4A_HUMAN | ATP4A | physical | 26186194 | |
| STXB1_HUMAN | STXBP1 | physical | 26186194 | |
| DPYL1_HUMAN | CRMP1 | physical | 26186194 | |
| DPYL3_HUMAN | DPYSL3 | physical | 26186194 | |
| DPYL2_HUMAN | DPYSL2 | physical | 26186194 | |
| NOL6_HUMAN | NOL6 | physical | 26186194 | |
| GBG2_HUMAN | GNG2 | physical | 26186194 | |
| KCC2A_HUMAN | CAMK2A | physical | 26186194 | |
| RL24_HUMAN | RPL24 | physical | 26344197 | |
| RS7_HUMAN | RPS7 | physical | 26344197 | |
| NOL6_HUMAN | NOL6 | physical | 28514442 | |
| ATP4A_HUMAN | ATP4A | physical | 28514442 | |
| DPYL1_HUMAN | CRMP1 | physical | 28514442 | |
| KCC2A_HUMAN | CAMK2A | physical | 28514442 | |
| DPYL3_HUMAN | DPYSL3 | physical | 28514442 | |
| GBG2_HUMAN | GNG2 | physical | 28514442 | |
| STXB1_HUMAN | STXBP1 | physical | 28514442 | |
| SYT1_HUMAN | SYT1 | physical | 28514442 | |
| TAU_HUMAN | MAPT | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis."; Wang B., Malik R., Nigg E.A., Korner R.; Anal. Chem. 80:9526-9533(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99, AND MASSSPECTROMETRY. | |
| "Phosphoproteome analysis of the human mitotic spindle."; Nousiainen M., Sillje H.H.W., Sauer G., Nigg E.A., Koerner R.; Proc. Natl. Acad. Sci. U.S.A. 103:5391-5396(2006). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-99, AND MASSSPECTROMETRY. | |