GBG2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG2_HUMAN
• UniProt AC: P59768
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
• Gene Name: GNG2
• Organism: Homo sapiens (Human).
• Sequence Length: 71
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction (By similarity)..
• Protein Sequence: MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVPASENPFREKKFFCAIL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MASNNTASI ------CCCCCHHHH	22.44	22814378
3	Phosphorylation	-----MASNNTASIA -----CCCCCHHHHH	29.34	29255136
6	Phosphorylation	--MASNNTASIAQAR --CCCCCHHHHHHHH	26.49	29255136
8	Phosphorylation	MASNNTASIAQARKL CCCCCHHHHHHHHHH	19.20	29255136
14	Ubiquitination	ASIAQARKLVEQLKM HHHHHHHHHHHHHHH	60.96	29967540
20	Ubiquitination	RKLVEQLKMEANIDR HHHHHHHHHHHCCCH	34.10	32142685
29	Ubiquitination	EANIDRIKVSKAAAD HHCCCHHHHHHHHHH	41.15	32015554
32	Ubiquitination	IDRIKVSKAAADLMA CCHHHHHHHHHHHHH	45.06	32142685
46	Ubiquitination	AYCEAHAKEDPLLTP HHHHHHCCCCCCCCC	53.43	22505724
52	Phosphorylation	AKEDPLLTPVPASEN CCCCCCCCCCCCCCC	29.89	29255136
57	Phosphorylation	LLTPVPASENPFREK CCCCCCCCCCCCCCC	31.66	26074081
68	Methylation	FREKKFFCAIL---- CCCCCCEEEEC----	2.31	-
68	Geranylgeranylation	FREKKFFCAIL---- CCCCCCEEEEC----	2.31	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG2_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG2_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GNAS3_HUMAN	GNAS	physical	20133939
GNAS2_HUMAN	GNAS	physical	20133939
ALEX_HUMAN	GNAS	physical	20133939
GNAS1_HUMAN	GNAS	physical	20133939
WDR26_HUMAN	WDR26	physical	22065575
GBB1_HUMAN	GNB1	physical	10339615
GBB2_HUMAN	GNB2	physical	10339615
GBB3_HUMAN	GNB3	physical	10339615
GBB4_HUMAN	GNB4	physical	10339615
GNB5_HUMAN	GNB5	physical	10339615
GBB1_HUMAN	GNB1	physical	19168127
GBB2_HUMAN	GNB2	physical	19168127
GBB3_HUMAN	GNB3	physical	19168127
GBB1_HUMAN	GNB1	physical	9789084
GBB2_HUMAN	GNB2	physical	9789084
GBB3_HUMAN	GNB3	physical	9789084
GBB1_HUMAN	GNB1	physical	15889144
GBB1_HUMAN	GNB1	physical	19376773
ARRB1_HUMAN	ARRB1	physical	18729826
GNA13_HUMAN	GNA13	physical	12399457
GBB3_HUMAN	GNB3	physical	22940628
MTOR_HUMAN	MTOR	physical	24462769
RICTR_HUMAN	RICTOR	physical	24462769
RPTOR_HUMAN	RPTOR	physical	24462769
RACK1_HUMAN	GNB2L1	physical	19917775
FYN_HUMAN	FYN	physical	19917775
FAK1_HUMAN	PTK2	physical	19917775
GBB2_HUMAN	GNB2	physical	25982117

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Acetylation

"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
PubMed: 19413330