| UniProt ID | GNAS3_HUMAN | |
|---|---|---|
| UniProt AC | O95467 | |
| Protein Name | Neuroendocrine secretory protein 55 | |
| Gene Name | GNAS {ECO:0000312|HGNC:HGNC:4392} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 245 | |
| Subcellular Localization | Cytoplasmic vesicle, secretory vesicle. Secreted. Neuroendocrine secretory granules.. | |
| Protein Description | ||
| Protein Sequence | MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQRRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIESETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPPSTQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPIPIRRH | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MDRRSRAQQWRR ---CCHHHHHHHHHH | 32.63 | 24719451 | |
| 153 | Phosphorylation | GPVVPKHSTFGQSLT CCCCCCCCCHHHHHH | 31.40 | 29083192 | |
| 153 | O-linked_Glycosylation | GPVVPKHSTFGQSLT CCCCCCCCCHHHHHH | 31.40 | OGP | |
| 154 | O-linked_Glycosylation | PVVPKHSTFGQSLTQ CCCCCCCCHHHHHHH | 31.35 | OGP | |
| 154 | Phosphorylation | PVVPKHSTFGQSLTQ CCCCCCCCHHHHHHH | 31.35 | 29083192 | |
| 158 | Phosphorylation | KHSTFGQSLTQRLHA CCCCHHHHHHHHHHH | 33.49 | 29083192 | |
| 158 | O-linked_Glycosylation | KHSTFGQSLTQRLHA CCCCHHHHHHHHHHH | 33.49 | OGP | |
| 160 | O-linked_Glycosylation | STFGQSLTQRLHALK CCHHHHHHHHHHHHH | 19.52 | OGP | |
| 160 | Phosphorylation | STFGQSLTQRLHALK CCHHHHHHHHHHHHH | 19.52 | 29083192 | |
| 170 | Phosphorylation | LHALKLRSPDASPSR HHHHHCCCCCCCCCC | 37.25 | 28842319 | |
| 170 | O-linked_Glycosylation | LHALKLRSPDASPSR HHHHHCCCCCCCCCC | 37.25 | OGP | |
| 174 | Phosphorylation | KLRSPDASPSRAPPS HCCCCCCCCCCCCCC | 30.68 | 28842319 | |
| 174 | O-linked_Glycosylation | KLRSPDASPSRAPPS HCCCCCCCCCCCCCC | 30.68 | OGP | |
| 176 | O-linked_Glycosylation | RSPDASPSRAPPSTQ CCCCCCCCCCCCCCC | 38.28 | OGP | |
| 181 | O-linked_Glycosylation | SPSRAPPSTQEPQSP CCCCCCCCCCCCCCC | 41.48 | OGP | |
| 182 | O-linked_Glycosylation | PSRAPPSTQEPQSPR CCCCCCCCCCCCCCC | 42.60 | OGP | |
| 187 | O-linked_Glycosylation | PSTQEPQSPREGEEL CCCCCCCCCCCCCCC | 36.32 | OGP | |
| 227 | Methylation | KPKKPTRRDASPESP CCCCCCCCCCCCCCC | 46.45 | - | |
| 230 | Phosphorylation | KPTRRDASPESPSKK CCCCCCCCCCCCCCC | 33.23 | 24719451 | |
| 233 | Phosphorylation | RRDASPESPSKKGPI CCCCCCCCCCCCCCC | 37.55 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GNAS3_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GNAS3_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GNAS3_HUMAN !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
