GBG10_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GBG10_HUMAN
• UniProt AC: P50151
• Protein Name: Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
• Gene Name: GNG10
• Organism: Homo sapiens (Human).
• Sequence Length: 68
• Subcellular Localization: Cell membrane ; Lipid-anchor ; Cytoplasmic side .
• Protein Description: Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. Interacts with beta-1 and beta-2, but not with beta-3..
• Protein Sequence: MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSSGASASA ------CCCCCCHHH	37.16	22814378
2	Phosphorylation	------MSSGASASA ------CCCCCCHHH	37.16	23663014
3	Phosphorylation	-----MSSGASASAL -----CCCCCCHHHH	36.76	23663014
6	Phosphorylation	--MSSGASASALQRL --CCCCCCHHHHHHH	26.70	25159151
8	Phosphorylation	MSSGASASALQRLVE CCCCCCHHHHHHHHH	27.32	23663014
65	Methylation	PFREPRSCALL---- CCCCCCCCCCC----	3.06	-
65	Geranylgeranylation	PFREPRSCALL---- CCCCCCCCCCC----	3.06	7665596
65	Geranylgeranylation	PFREPRSCALL---- CCCCCCCCCCC----	3.06	7665596

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GBG10_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GBG10_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GBG10_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GBB1_HUMAN	GNB1	physical	19168127
GBB2_HUMAN	GNB2	physical	19168127
GBB3_HUMAN	GNB3	physical	19168127
GBB3_HUMAN	GNB3	physical	22940628
K1H1_HUMAN	KRT31	physical	25416956
ITF2_HUMAN	TCF4	physical	25416956
KRT38_HUMAN	KRT38	physical	25416956

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Prenylation

"Isolation of cDNA clones encoding eight different human G proteingamma subunits, including three novel forms designated the gamma 4,gamma 10, and gamma 11 subunits.";
Ray K., Kunsch C., Bonner L.M., Robishaw J.D.;
J. Biol. Chem. 270:21765-21771(1995).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], AND ISOPRENYLATION AT CYS-65.
PubMed: 7665596